Norwalk Chronicler

Norwalk weekly gazette, Tuesday, September 2, 1884 · page 2

← Back ‹ Prev page Next page ›
n / p pages
1

 

 

 

 

 

 

- . , - - .. NORIWALIK GALEI‘TE, TUESDAY, SEPTEMBER 2,1884.
N L G ETTE Haven. Loud calls were made for NOT FIT 'ro BE PRESIDENT. POLITICALIPICKIN‘GS. - mama-Arron nmxx neuron. List of 1mm remaining in the Post _ I . . ‘ ’ ,
ORWA K AZ ‘ “Lounsbury,”and-tllat gentleman mount- 3 ‘ f 31 Immo r a1 Life Grover Of all the enthusiastic receptions ex- '_ —— '. Office, at Norwalk Conn. Aug. 30_ MRS“: Hill, 30. Nfll‘Wfllll. . 4 ‘ ‘ , ' ‘ ‘
-—————-—-—-————""""~ ing the stand, he was gseeted by three ' en“; 0 ‘ " tended to Gen. Logan in New York state, moment 81110118 15118601110831” 0110110 Ma A . ’ ’ ' _ , - . ..
_ eveland Should be 39km, I _ . . f th . bea tiful . . tli ry thetln, Mary Buckley, Charles 8. Wednesday Eve 0‘ Sept 3d .
Tuesday.SeptembeP2.1884- hearty cheers and a “tiger.” He respond- ‘ that at Bufialo was the llcartlcst. Right 0 086 . u plantations 1n 0 gougpnbhaura E. A. Cha man, W. W. Clark, 139 _ .. r I . .
M 'ed in a happy and feeling speech. H. K. There is no doubt that supposed avail- under Cleveland‘s nose occurred one of s“lump .1981” 9‘ Georg“ “ll“? “1° BQZI‘Lt‘fi’Efifi’fieggfufiegafigthflh‘; gnu main onmr. ‘ .
30 ubnoan “dbl-0351 Ticket. SGDtt, 0f Ridgefield; 'J. H- Olmsteadr 0f ability was the sole reason that controlled the most significant republican demon- 11198110118 8!?an and the 1173 03k fl’Michele Mnrane,Mis§ Ella Mills, Johii Me: ' Engagement of the Distinguished Comedian, I . .
' P --""“' ' Stamford; A- 15- Byington, Oi- Norwalk; the democrats in passing by such men as stations of this intensely republican cam- 911118105 3136;] Dishalzkshaftfim 4:0 Feb-1'3 grill-fill big; gggghllgseoluehnfiisscggznfih MR J s M . ._ I I u I
ENT ‘ -’ D. l f S rin - . B an] Tlurrnan Randall and hi n. 380.“ , Y , “0n 591'“ Sanford: The G'lb tL k I Z " B, ' "
FOR PRES“) ’ ex Congressman ’ Clafiee’ 0 p 3 M888” “3 ’ .‘ ’ p g ant. intelligent. obedient. courteous, and ei'at.”2,Willialln ThomggonFC.’ HTl'iirllsii-rni, ° ' ' PHY’ ' . .

Burt Weed, Robert J. Walsh. In Marsden’s Romantic Irish Comedy-Drama,

' ‘ field; Gell- Aiken, of Norwich and Gen. others of like stamp,.in nominating Gov. , “Yes, I am a Blaine, man, and in this .I

- - - - ‘ - - - with the manners of the old shoo he

James G' ane’ 0f mane Noble, 0‘ Bridgeport, then made appro- Cleveland as their candidate for pI'ESldentc election shall vote the republlcan ticket for was now verging n'p on 60. Among 01ther Attest CHAS. (harem/m. P. M.
____‘+,_._.-

ntltled
. . ‘ . o u n ” tlle . 9
FOR VICE-PRESIDENT, prlate addresses. Their theory was that he would run best, the first time in my life. So says , d id ‘1 . . ‘ .
' Haven ', at state of ular Irish dramatist Bartle Cam - 11 ea evolveduponhimwasthogeneml Slop “Bing haird es and be in the use of
Messrs. Rufus S.Plckett of New 7 and be surest to carry the gre pop , Y P . . on of the pi lutation infimaIrYy that vauable hair pie aratiou,gphhnel.’s Hair G ’

JOhn A: Logan! Of Ind-H.015. and James H. Olmstead of Stamford, bOib New York, and especially that he Would ' bell, and so say many other Irish Amerl‘ where the Sick v full arsed and Tome and Restorer. t surpasses all pomades . . ‘ - ‘ . _‘
native born Ridgefield boyS, made stirring bring to the party a large accession of cans. . “1“" y l1 and one" It ‘3 “"“v‘ned in its delicacy ”"1 '
supplied withmedlcme and unstable food. agreeableness. It“ perfume is delightful. Ill Played by him with unparalleled success'ln the " I

Will be Prepared aboutthe

 

 

 

 

 

 

 

 

 

 

 

 

 

- . lmstead followed Ml“. re ublican votes. Mr. Blaine has anothérbit of good luck. _ . . _ . . _ ,
Republican 8““ rickot. filir‘iglflsii'y. TIE-(l aomong other good things * ‘1); turns out’ however, even before the hIr, John Bright dignpproves of him be- cqumg oomderable kanledBO-Im bill'sltfgillilfol‘byslllglilfgguiats till-:2. n0 pOSSlblC lll ’lvlvllitliitgggbttjlliilifrelsdl'g £$e£fil3é iifihgtlgfgggfirfgl-g '
For Governor, said: “That man must be a' very hard active work of the canvass has fairly be- cause asIa protectionist he is adverse to tclilt‘iaeigegt‘laifing gal-12m 03:38:81? 1;“; ”mgr- Rendered bra . T0 D. 1 Th _
‘ 11 «we indeed, who could intimate that our gun, that as to a most vital question of English lntercsts. b , th . pr 9' f 11 I was: BIhby was sick, we gave her Castori Powerful Dram all C CO m' an . . . . lSp ay elf
HENRY 3' HARRISON, 0f NW aven. great hearted and great natured host, has personal morals, the‘private character of Cyrus Hamlin, D. D., LL. D., president ecome m 9 who“ 01 his 6 ow- When in: illlifiiii‘i’sfleoit'fig {groggstbi-iaa’ ' p ‘y I ‘
For Lieutenant-Governor, but 1* POthbOOk “Stead 0f bruins, after this so-called reform candidate has been of Middlebnry College, Vermont, writes: misfit: :gonétieecbgndsefiffiogg “will“ had Children, she gave them Castbria. End’s: Jibcnil’lgggiv‘iiinlieoi. £31385 Iiéliiiflliilqoléiili ‘ , I .
LORRIN A. 000“, of Barkhampsiead. listening to his ablest impromptu addl‘CSSg one of such rottcnness as justly to destroy “I vote for Blaine. If 1 vote for any one sion ”1:1 dlignit; to . am 8. bltl’od let- PERUW’W scenery and elegant, toilets. . L A N D .
No friends 1 do not agree with Mr. all claim in his behalf to the confidence else it will g0 for Cleveland—thatiS, for . . m “139‘“ . Debllity. Liver Complahiinfiblllsiygfriisgils’ 833333 new scans AND sauces
For Secretary Of State, Lodnsbury iii politics, but he and Iwcre and respect of the American people. free rum, free trade, free loye and free {11118. toadmmister purgatlves, ["980an Egarghfihel‘tfirvogs Alte‘ffl‘lgs'llémme colnplamls‘ . . . ‘ 7 ,
chums A. RUSSELL, oi Killingly. Ridgefioid boys together. I know him to Whether the members of the democratic devil generally.” , pgritlbafthljioo?dtor:3:$e$ $321359” Iblood. ( Bea es orig na ng in a baltate of the PopuclggtSIZl-iggé $351131:th 53331.5“ 50 , W1 h . , .
er be a man most richly CHdOWBCl Wllll convention were acquaintedwitll the facts The democrats say they are going to _ - I . " ' _.;:.::_::::-::.-:_=:_-_-,—_-:;;;;;; I I _ lie I. . . . . .
Forgéillglll ’of New Britain. mentally and generous and noble as we in his priVatc life when they nominated carry New York, and therefore the coun- EOMSEWbOf fimdt'mfoumbefdcasltzrtgil For sale. Ng‘gagfigg,gggpggggrggygr; 239”“ 30- they cordially anlte the public to examine,
"ENTIRE To“ ’ all know him to be. I resent with indig- him we do not know; but for their sake try. This looks like it: A prom dent mg {hr a 3:: f tur en Chestnut Standing Desk Apply at Danb Th d ‘ I 4' I .
For ComPiTOllel‘z nation any imputation that withholds we will assume that if they had known gentleman of Port Henry, a Nev York at; “in: ”he" “Ii-gig?“ al 9:930 t 5' “I; A ' Tms Omar. ury, urs 3y bent - They are ClOSiD i: th .
LUZERNE l. IUNSON, of Waterbury- . from hini the full tribute of being a man them Mr. Cleveland would not have been mining town of 3,500 inhabitants on Lake dose, andlfinall Emigraopom tyo brace .s . ,. g 01] 811'
. of brains, ,which {is justly his due. We the candidate of the democratic party. To Champlain, was in town recently and said up the haltingy system constituted the F03 sunl F. W-. MITCHELL, _ _ _ _ Mann“ . .
PRESIDENTIAL ELECTOBS- , who know him, know how false and Silly nominate such a man would imply a "105‘ he had counted 130 of his fellow-tOWbs' practice in vogue in (loses of ordinary A MILO“ cosy] B . OPERA EOUBE’ SPB | N G A" D s u M M E“
At urge—Tampons D. Woorssr. New Haven. and futile must he the effort to spread aetounding lack of commonsense and an men who had previously voted the demo- fever. If this vigorous treatment failed 32.“ “less on 491. NomalkI Com FRIDAY E VE’G EFT I SUITS
own A anlxs, New London. abroad such an unfounded impressron," equal lack of moral and political integrity. crutic ticket who this year will support of- the desired efi‘eet a repetition was , S . 5. I I
Districts—l. I.Lu-rm Spancnn,8ufli°ld- ' Attire conclusidn of the speaklngl the Certain it is that the independent repub. Blaine and Logan. They appreciate the gene rail y resolved upon and so the For Sale. . —-———-— ' . AT A -
2. Josm E- SILLW- Chem"- veterans and their friends 1113“?de t0 lbe licans who ignorantlyendorsed Mr. Cleve- dangers of free trade. , patient, sometimes enfeebled to such a DOUBLE 13 ARRELLED RIFLE made by Jolin 5th Annual Season, ’84 and 85- .
3. Janus S.Arw00p,PlsiInfiolll- depot where, at 5 p. m., after three hearty land and publicly declared their purpose A Boston teacher visiting Pennsylvania degree that he no lon r afforded attract- cash Bfiifisetlt, Li'iiiim' wm be 501,] cheap 130,. First appearance ““8 season 0, me EMINENT . . .
. 4, Follower Mmss,8ahsbury. cheers far Ridgefield, they left for home. to support him did not know the man writes a friend: “It is all Blaine and ive food fordinease, sifwly recovered in .,_..- ani‘en sonlcc. I __ columnists. _ GREAT DISCOUN
/ Thus closed the reunion of 1884, all event as the record of his private life has m- Logan hero. The Irish democrats have spite of this heroic “dootoring." As a , For Rent. . BARRY & FAY T.
Reunion of the 17th Conn. Volta which, for supreme enjoyment, has not vealed him to be, and WhiCll record, by formed a Blaine and Logan club here and supplementto his labors as a physician HE upper pm of ,1th fronting on Union . _
The reunion of the “old Seventeenth" been excelled by any reunion ever held by God's lightning voice, has been sent With they declare that Governor Cleveland will ‘DaddyJaok indulgedinamde wayin the g‘mll’gtrk- Aggyfgthgffls 'cgosmsmn Elven 3;“; l" “l?“ “goiggrffihiggcficcfflf‘gghlg’fi’ WW“ BRYAN T. BESSE & cod

at Ridgefield, Thursday, was by all means, the old Fairfield county regiment- a flash to every village and hamlet of the not get a vote from that class of voters.” art of dentistry. He undertood how to cut

the best and most enjoyable that ll“ ever REUNION mums lscnnoss.‘ nation, and thence to the very ends of the The Lawrence Journal .(Dem-) tolls its ~ (I an aehin teeth 1,], the same Situation \Na “ted. AL L G R A z Y .
aroun g "I o I T H
, i '. ’

ous old regiment. Jones of the Westportemwas on hand earth. These republicans cannot, in view demohrafic readers that if they can mm a lancet which he employed in blood let- A YOUNG man, 17 yam of age, just from

been held by this glori .

The people of Ridgefield had used their but somehow missed his boquet. . of what they now know, give him better candidate than Grover Cleveland to ting from the arm. He could annihlate m tosghggi, ahhltfiegsposltlw in some store. Will- pmnmmced to be the funniest comedy ever mm
greatest endeavors to\ greeft 3hr: 1yetteaans Royce of the Comet lIookrtgil afltIerkhlS their support wIiithou; thegrtflsseih seIlIf- vote for him. For itself, the Lawrence unexposed and throbbing nerve‘withIa It: . ., B.J.G§\V1121?IN%R, “In. Supported by a . .

cordially and made them ee a .le.y favorite source ofinsplratlon, lecuc en. stultification, an , in cc , mt, on 3115 y Journal will support Gen. Butler. tenpennynailheated red. hot, Wlth the “WW—— _I—_IIIII on, 3,171,; _ I I ‘
were honored guests. All the prellml— The smiling face of Comrade Hubbellr exposing themselves to the charge of The New York Times has got so far use of an old fashioned extractor; with Want to Exchange (“Mildly Ill Galllllllli Excellelliifl. _ 29 Main St ,/N01 walk, Lon".

WSeat s on Sate at Plalsted’s drug stores, Nor-

naries‘ had been carefully arranged, 9° of Saugatuck, Was noticed, and he, With grossand senseless hypocrisy. The simple along Wltll its “independence” as to refer “’11le to pry out an offending molar,
walk and South Nbrwalk. '

 

 

 

 

1&le occurred in thel progtramm; and his estimable Wile: enjoyed the day and and pllain gimbals unit the :dmitted offence to Degree: as“coons.” The gait step wig sometimes even at the expense of a A SESgNDshnnd llehvy two seat top rallnlIlIy (Illi- , .
there was not one unp easan lncl en 0 the exercises. ' of w ich r. - eve an ouc res uponIa be to call hem “niggers,” an t leni w1 fractured jaw he was familiar. In the b I lllIesl twtagon, oIIra nch or IlltrIlIc-om I Ihn ,I go “1 1‘ . ._..
m“ the enjoyment of the day. Willing Ml“ 01in Chalice, 0‘ MMSfield’ was domain 0f family and public morals 90 be ready for full fellowship'iu the demo- absenceof asiiitable instrument a strong withgsiytorii;lwriiglhsygiim‘éi‘glggf’e or m 01 p 3' Pnees’ 5° and 75 Gts' .
hands had done their work in decorating present, for the first time, and means to vitally and so dangerously to the public oratic party. . twine string, well waxed, sufficed to pull 3" Apply at GAZETTE OFFICEI MUSIC HALL SOUTH NORWALK _ . . .
homes in honor of the visitors and Willing keep track of reunions hereafter. good as utterly to disqualify him for the ThesSavannah News desires us to ac— out an incisor. - . . #4! 0N1; NIGHT l » . . I . .

9 ~ I .

hearts bade those same guests a hearty The handsome and tastily laid out oflice 0f PIGSldelltl 01' any other office l“ count for the announcement that/the fac-

welcomc. Everywhere were seen thong:i grounds of Comrage Logmbfrythyfir: the gift of the people. This is theIIposiiion ulty ofBrown Universityis unanimous for STORAGE 013' T135- ounyorsle 5:1 ssaa‘lf- I a I MONDAY, SEPTEMBER 8_ . . .'
. - . - - "-‘ , o n , n or o ' -
and smiling faces and all, gues s a greatly admired, an num era the Independent, after a ue consl era ion Cleveland. It ,5 done very easily. It re- S 141 co the era of steamers the fact is Y drive. 3 (pm: tilot In ltlhtee mom“ aATsoa . , ,
nearly new top Buggy Harness, Robes, etc. For . §h00k.%. &‘%’@011]er 8 ’ , _
. . I

host, lent themselves heartily Ito theIfull itors spent considerable time in walking of the facts and our duty to God and man, salts from the prevalent tendency of some . I
undoubted that cargoes do not amve in sale cheap._ Enquire o

 

 

enjoyment of the occasion. through the shady drives. . took last week and means sternly to main. democratic newspapers to lic.—Providence . I . _ .
The day itself was all that could be Mrs. Lounsbury fulfilled the duties of tain. Any effort to evade this conclusion Journal. , :fiafly 3: googIcondltlonbas tmththe old 38Main ngsg‘llgglfilogtfgggvglk. , - To Red . t -k d . a . ‘ .
doSiredr clear and 0001! the pure 3" from hostess ill 8 happy manner, and many. only makes the duty the more obvious. A Quincy correspondent sends the fol. lpper ys. _ 13 a on 39:11}. ---> COM BINA'IION, ' R d . “w s 0" an make “Pom lob ball GOOdS,’ I Will give a
the Ridgefleld hills seemed ‘0 P“t “9911 courtesies were received at her hands by If it is said that what is true. of’Mr, , . “ id 11 d monelftIform of damage known, 81} 1 _13 Agents Wanted. - . - . 0 action of TEN PER CENT. for cash. Rubber Goods .excepted,
I . ddi , l _ , . . . lowmg . A one legged so let on e at 8,11.er how small an escape wrll taint In Buchanans Great drama, . 10,. THIRTY DAYS f- A -

vigor lnto the men and lent a $10118 the gentlemen and ladIy Vliltms- Cleveland is no more than has often been our office one day recently and upon being in? t' f tea 0 th th r m: CONNECTICUTINDEMNITY ASSOCIA- ' tom “3““ 9th THIS IS NO HUMBUG.

leasure to the day. . The residents of Rldgefleld seemed to true of other public men, then we reply . _ . a ge quan lty o . n . e o e T TION prom“ Sickness, Accident,Deathand, .
p . . - d . - ' . . . - - asked by the proprietor If he should not hand damage which 18 pttnbuted to Old Age benefits allunderonepolicy. Moremoney o

The tralnrleft Norwalk at 9320 a. m. an we wrth each other In endeavonng to Tell- that it is high time that all .pllbllc men vote for Cleveland replied'- “Not till that t ' f . d . ‘t in this plan for agents and better protection for the . 9 one Lot Of Ladles’ ButtO Sh
eight cars were closely packed with the der the visitors cheerful and contented. should be taught that personal and private leg grows out n‘ and added the soldier ileum (:Ietendhas zlothmg toi (truth 1 - insured than any othCer.n bliggivtgmv Gem Agt mm A , I n 068
veterans and their friends. At every step Hurrah for ”1‘1 Ridgefield “Pd long live vii-file is not an immaterial question with “I don’t propoile to fight on one side and midlife tonsfefinlemt 1‘12:th 3:31;. _ ' ' NorwalkHIotel. 1' $1, worth from $1.75 to 33. A little soiled
on the line more people got aboard till its generous people. f . the people of this country. This lesson vote on the other.” they are packed :anin pro pngion as “I: . N t OWERFUL miss. I . _ ’ I
one would have thought Barnum’s Cll‘cus Upon relinquishing the office 0 presr- should be so emphasized and proclaimed . _ l . 0 Ice. Messrs. [I‘Illlohlk Istgolligr take pheasure in hn. L t f L d1 S d 1 SH 70 t
had pitched its tents again in Danbury. dent, a vote of thanks was given Comrade to the world that there will be no mistake \ Eta-GovlerlIllorNNoyels,0 (:{f (231:; $113011? l8:er 21112::ch tilt: aritcle £3112: yIfar ALL PERSONS Desiring to drive on nouncI g la meiiis a?" ma e arrange O 0 3, es an a pperst c s.
Reaching Branchville four of the cars Lounsbury. ' now Or hereafter as to what is meant by it. Ijus “TSP: E9“; 1 r 1 l p ’ Ti: ti ht rolled, h 'pd w; h wl: if the Track at the Fhir Grounds can The Survivors of the late Greeley Lady . o l I
were attached to the train on the branch The Mutual drum corps of Norwalk, The immoralities of a man's private life says:— e ngIls l pepp (I: Ian; press; ears g - t if at filial? 0 (1 th procure a key upon application at the Franklin Bay Expedition wllo will accorri- . Ladles, LOW O era sli ers .

are, for the most part, tun 1n avor o y ago wen 0 vary 9, an 0 CENTRAL NATIONAL BANK. pany Messrs. Shook & Collier’s Storm’ , . I) pp . ,.

road and soon we were off for Ridgefield- presented a fine appearance and did some are matters which so concern the public, I . . I . .
ssar dela and the . ‘ ' , - - , Cleveland‘s election. They fear Blaine s merchants 0f the 18.81: generation almost 24tf I Beaten Company throrwhout the United Good St 18 ahd Good Sii rs 90 .
There was no unnecce y y excellent drumming _ when that the public, With the knowledge vigorous Americanism, and don’t like him classed tea With wine and 0i and States and Canada appearing in the y ppe , cents

‘1“le and safe transportation 0f sucha W of these immoralities, is asked to make because the Irish people support him. considered it rather the better for BI EN AND “TOME A‘gfiifin GREAT ARCTIC RESCUE SCENE .Larg'e Stock Of Regular GOOdS I

 

 

 

Cl'OWd reflects credit upon the railroad Mr. Ipunsbury in Line. him the chief ma istrate of a rest nation. . . \ . . _
management. . On the occasion of the reunion of the' A debaucllee, kiown’ to beg or to have Idvelr zlnchBlalne’Is manly detflentile of the; if)? Illllsreas, npwdayS, ltI illiblkaifl Iii-Good Salary and Expenses Paid. (1
r t 'n arrived at Seventeenth Conn. Vols. at Ridge— . . ris l-l merlcan prisoners on re oors 0 III. pr0per y, as a pens e at l- OUTFIT FREE. Noexperlenceneeae . . M , .
Ridétffiildlifilfifrii (it; pfclked with the field, Thursday, a reporter, of the New r56312uggcf 2;) $122,321: at; tbzseflfl‘iiiizg Congress, the English have not regarded Ole lllie butter. Considering that tea is 8% J’mESE-Wl‘llnebN“lseryma"’n°ch°3l°bN'Y' Ad m THE mmmwn en 8 an BWGd 4. 50 and $5.00
. _ . . . , - - - - ' ' Seats on Sale at Iloyt's .
. . 1 vi t1 e Haven Mormn News embraced the oppor- . him wrth great favor. . packed 1n wooden cases With close Joints, . nus 1 Is 1 I . I “ , I
veterans and their friends. ea ng l 9 States. This one fact should be fatal to and almost hermetically scale d in lead, GI V en Away, Still 50 flilll 75 am Spencers , achlne ‘I‘ 1.00 to $ 4 5O
0

' d with two cars tunit to interview Mr. Lounsbury in rela-. - 'Tlle democratic tactics sa sthe Tribune , _ , , _ , .
WhBBlel‘ and W119” ban y him- The Poople should “0'3: and, “5 we ’ y ’ the astonishing how it Will get tainted. GAY’S Encyclopedia and Self Educator, Gay’s -HOME LAWN SCHOOL-

 

 

 

- .' ‘ . ‘ for - - - ' 11 d' l t Tl e industries . ‘

at Branchvrllc yet to come. At the depot tron to hls support of Mr Harrison believe Wm not so disgrace themselves m are thoroug 1 y is loncs , 1 Standard History of the Worm Great _ . . I
the members of the association were governor. The following extract from the sight of God and man, and defy the of the country have been greatly depressed A (1::ng was refutly seen wheres whole 1,33%“ Itne Ylglllet “hmliyAiilf “mg“ 3.206;“, ‘v‘lifrfliilii’élzr’éfilyb'égi‘pféa3533;512:352?“ LA DIES’ FRENCH AND AMERICAN

received with three cheers by a committee the interview we cprdially commend to\ imperative mandate of sound morals as to ever since the election 'of a democratic ware use caug It the smell and flavor of pggogggtlhggsup 313g“ of thougfiheIc-hmd a“; Latin School, _ o . ~ .
of citizens under the lead of Dr. Chafiee, those parti he have so frequently bestow this honor on any‘sucli base pr ofli- House in 1882. That prostrntion became filling“ merely, ll? 18 said, from oranges igrlilgfldillsilliiii‘lggst' For circulars and special in- CORNER BELDEN AND WEST AVENUES. 1d 010th and Kld Top Shoes
president of the day. ‘At 11:30 a. m. the asserted that Mr. L. and his friends were gate What isom common Christianity more severe, and to the working people 13:21:11in gbeei‘hv (Lanh'led gaggigaat oia :11; “bias HI; lipmlis’lrn TEgsPI—sso PER YEAR, I '
' - “ ' - ” dwould work for the defeat ' . . . . . - 1 t - 'h tl e democrats - ave 0 1 s e ‘ I 00!“ . .as 11”! g. peca rates for younger pupils, - , - , ,

'remalnder 0f the veterans and the band kickers, an worth, and what 15 our boasted C‘Vlllzal‘l‘m more dis lear enlng, “ en 1 that in oneor two warehouses where wine “21 New Haven' com} 1" MLSTIEIVENS- ‘ 1 “ill 3, 13333 , Bills illili YiillilIS’ school Sims.

arrived, 265 strong, formed andmarched of the state ticket. Mr. Lounsbury said: worth, if sucha black stain in the charac- devoted the last session of Congress to a is stowed all thotens run'more or less Notice.

up Main street to the spot where aBritish “I am for Henry B. Harrison, heart and ter of a candidate for the presidency is, in desperate effort to cut down the duties, ”Willey." This flavor when natural to THE Inhabnams of the town of NOIWI‘IR are T» fiIS’S BAIRh’S INSTITUTE M New Made Rubber Boots _ lst Quality
. , l , 1

battery was planted during the revolu- soul. I shall work for lnm. He is the the popular estimate, to be deemed amat- and, in the language of Mr. Dorsheimer, the tea is not considered objectionable,

hereby notified and warned that a Special

. ‘ ' ' lllef - 1 l f ' d (1 official bio ra'ller of . ~ ~
tlona Slim le countermarched and tOOk man I want to see m the Chan Of the c e al 001158 uence? What 8 t w c ose men an 3 p - Town Meetln will be held in the Town House in
l'yI gg v . th 'd e ma istrate of this state. The reports in- ter of no sp or q , . Mr. Cleveland to take “a first firm step but when caused by any foreign contact midNomalkfim Saturday, September 6th,1ss4,at —F0_R— . Woonsocket Co. I .
up the line of march vest ovelll‘. en 1in d gt . 1 . 1 t d by certain of the strange spectacle such a lawbreaker, if t d f tr d II Y ttl if prices are heavily affected. 20.010“,i Mmmoon’m mung; and, not up?“ the _ _ - . .
halted on its summit, where t e mars in us rious y crrcu a e . elected, would present in the parlors of owar rec- ra e. e le very su er-I In ho - following petitions, vlz., rent on o Angus us . ,
.- . . . . usehold on boards tea ma often G cl (1 0th 's—To instruct the Selectmen to as all I Come and 560 before 011 bu ! ’
mg When the“ own misconduct caused, P y retiilovt'lg fii'ltllm thglhlgllway the building standing I y y

announced it to be the place where a state papers to the effect that I feel very the White House. What an opportunity be seen stowed next to cheese, apples, ne me prowl to the schoomouqe In the Down
at up - .

house was burned 'at night durinn' the. sore because I was not. nominated and 't onld ive to Mormon 01 amists to the democrats are now ascribing to the . , _ n I , .
trl' 1e as a Signal to the armay at Will endeavor to prevent the Cleatlon 0f 1 w E] 1 there at til; eyfigorts 0f the 'l'epllbiicflll party and its policy. To lemons add OTher lughly.S-cented wholes ligflngdljotgligDigbllI-ilcetfl litily'. sallflillfugfiwlallghfiig NORW ALK) CONN! ' A H HQ fl - '
S ugg a Slicer all 311% l ‘ . of consumption. and then the house- and Solomon E. Osborn. Also petitionotA. Dibble m —— _ El I g 5

°‘ . ' liolit ‘ l ' tl states the democrats . - A - ' ' ‘

Norwalk. The march was resumed to Hamson are not only utterly Wlt general government to suppress the men. peop e m 30“ “3m kee . . . and others to (meet the Selectmen to lay outa Botmlmg and Day School (laughed to ,

. . A . , . . _ . . perils surprised at the various flavors . . .d N m “I. ~. _ . , , -

Mam street, where another halt in front foundation, but they are dehbemtc and strous abominations in the territory of openly “VOW the“ free—trade purposes, combinedin a single cup of “unrivalled figgggggg‘gfiggg ¥$Xfirf§affilng fgoma\llil;grriis meet the demand for a more film-Mtg” Under 0133!“ a HOUSE, W all Street, Nor’wwlk.
Cornerto Five Mile River running in a Southerly and liberal education of girls.

 

 

 

of the old Ridgefield hotel, and its history malicious falsehoods. If Ihad been beat- Utah. What a demoralizing lesson it but to voters in Maine and New York early-picked.” .It may be argued that“; I I II h 8 II I
was announced as having a cannon ball on by a dcmagogue or a Wire-puller It would be to the young men ofthe country. they deliberately tell falsehoods about llle flavor of cheese is preferable to none at 3l'gfigg’geié’glfie‘glfd‘;fight,g Echipgfit, $.35 Tm, COURSE or INSTRUCTION —"‘““'“'”’ ....._--__ "*w— " --_.__,_.,,_-..,Im_. ———- ———____
imbedded in its timbers from the British would have been different, but .I know Of What a barrier to the successful teaching matter. , ' all. but as “. good wine needs no bus n heggggrghggggglggggfigafilgfglol‘lgg‘gg 3.92% Includes all branches usually taught in sommarleg - '
battery located at the north end 0f Main no man 1,“ Connecticut W110 13 so well of morality from the pulpit or political "‘ Anything to 'beat Blaine” is having a so does good tea require no flavorini’r; {“‘fi’ifi‘ifiati‘frfié’l‘égrt‘i‘l‘iii‘fhil‘imtififié‘fi‘nl‘i‘t‘i Sfififligggfi‘n‘ifefl‘vifgittfiinféncfiglvli} 523,:2fiocl’gg ' l .
street. filled to due“ Slate “m“? as Ml" Hém' platform or in the halls of Congress. All .new and financially practical exemplifica- and good tea. can still be bought if the now ,‘3....i.§.. of the right of way felmI’sald highway £31315 thelfldgamams of a thorough, practical and .

The regiment then marched to the town son. A lawyer Of‘tlle hlghest Standlflg’ decent people, not to sayChristian people, tion in the state canvass in Maine. It is public will only pay a fair price for it. gggngoggggkbgyggg33,13,535;gaggsisggygyff negltlilcigdatoeiribilalibg’ihatlig Eghfigwrfinéilngtléfi . PPERS
hall and were called to order by the pres. hisbitterest enemies dare lnsmuate nothing would have to .hide their heads with a said money is being poured into that state The experience gained by the case in ' CHAS. H-RVHEELEll. Sllggggggfgggggffig year a 08mm and “be I j - ‘
ideal; of the association, Comrade Phineas to his discredit. IHis reputation in the profound sense of shame and disgust. like water by the democratic state com point shouldimpress on all retailers the lévgkg.gAlhtff\lltl§: }Selcctmen. fiiiii’rilsoilteliblnwmnaen‘lélmid t? Elwufigflflifiy . .
0- LOW“??- ‘An address °f “mm“ “mess and “ml “rm ‘3 “b0“ ’6‘ No! No! the majority of the voters of mittees in the denominationsefnew two necessity of carefully selecting the place fated. NorwalkfirISePt- 1-“, 18943 lit?» drilled ll. oorreofir‘ilnorcel‘ét‘ltilfi‘lidi‘fit‘i$2332 For summer wear“ must be closed out re ardless
was made by the Rev. Ml“ Leel 0‘ preach. I am glad to be beaten by “Ch a this country will not and cannot approve and fivedollar bank notes, which are used for stowing 'tea, removing it from any - N t 33333;}5g:33:33:01;gaggilgllfil‘hcéfggsfigg ’ l . g
Rldgefléld: and was touchingly resPOndEd man and he” in Fairfield county I 51m“ of any such beastly and heathenisll stand- in buying everything purchaseablc to vote stock likely to exercise any injurious 0 Ice' \ $330,, yin! filler English classics will be used in . ' 0f COSb at
to by 001. Henry Allen on hehillf of the prove what I say. Falrfield county re- ard of morality.—Independent.- against the republican state ticket next ’efl‘ech' a precaution neglected by many °§i$§§§$fi¥§d£¥§fif¥fié b33333: Hlfgfiliifi Lama‘s; iiiiifiiirloi'i‘dl‘é’é‘s’fid‘ll‘gglgfi’ggml: .
regiment. The business oftheassociation publicans, and fill am not mistaken,many . week, and Where voters can’t be tllus grocers, to their Own no small detriment. surance Company will be held at the ofilce of said that:$1113:e‘gfi‘fgeéllloggzlggglmo‘ls-‘ialgely cglgé'Ed- _ , ' ’
was then proceeded with. The minutes - Fairfield county democrats Will “lie for It Shines For all. influenéed, and can be hired to keep away . ___.._...._.._._—_ . ggggfilégig? gglgghfiophggfigggggggsgg ItltilrlcalllExercises, épeciill attentlgn is 31%;: as iii: _ ' ’ . - _
of last year-vs reunion were adopted and Harrison. His following ln this part of Tort correspondentwho inquires, “What from the polls, .money is freely paid them mums 6a? A flair. {liz'ivil‘ilglclgefltfi 0,: 33%;] {333.11% 53:31:13; tilt: 38,3 :2: ”53¢th pig} ggplgrgfitggehgggnthipé these branches -

ter which have heretofore been made by the Gener- segfiéhflgi‘eitg‘fi? till tll’leewgilgdggifdfiig:gigggltswliils]

file treasure! made hls 19130! L Ihe latte! t E . 3 3 I l ale Sou! reasons for left-[Slug t0 Supp: t for 'tl‘at. The pu1pose 0f the national “Well it's ill] Elli? E i: 1- n l i . -

shows a balance on hand of $109.57. The Splil- My friends all feel ‘15 I do about ~Cleveland ?” the New York Sun replies: aemocmfic committee being to reduce the _
. . . . . _ , . a tram ticularly the following. viz. The amendment and .
monumental committee reported that it the nominations 0nd Will entliusmstlcally He 13 not fitted to be premdent, either republican majority in Mr. Blainc’s own . P to one “.1113 fellows. on the alteration approved May 10:1860, to the charter of gglllfigységfigariigfiéneait itlhat individual attention » . ,
. . . , h, t t ,- k, . . .. . station platform; “Just you keep your momma Marine and Fire Insurance Company, D 9- own make are fully warranted in ever res t 0
had attended to the duties assrgned ‘lt, support t 18 W 0 e 8 a e 10 e - by intelligence, personal qualltles, exper- state next week to the lowest pOssible eye on me an' 1.11 show ver a. trick what’s glancing the namecoisald Companyto iii: Norvz’lililk LANGUAGES. ‘ 5 Y p90 - lll‘
' ' -————<+>-—--——. ' ' . . . . ire Insurance om an an ma' 3 0 er Pu il d. . _
contracted for the stoic, ragged. the IlI-eqnlr; Camp 811mm“ 18110; or publlIchI lslerlzlcheIs. He has some p‘omt, so that his home victory may not wutll havin’ wid yer. Go down there changesT in altlfilglgzartgriatitild the algendlheptjap- Lathli),Hillel-1ft:liiiitieGellfillinbfiiilgl‘llgggstages “l the l . do 9 fl . '
- n e s o ' oo oin s u is e ciencies are man ° - - . ~ » . roved.une' 2; an eamen men 0 try , ' . . .
9d sum find erecwdt 8- ta eto t p g - p ’ y be 0‘ “fluent magnitude l0 Sbmlllale behmd the water-tank an’ wait for me.” 54th, 1872; arid t’his Stockholders meeting is also . nusre. . 1‘] "BS and-Made Ffflllflh Kid Button
mrm, if said meeting shall see In to do Faithful care is bestowed upon the pupils in . ' -

Governor Waller and Adjutant General . . _ . . .
and ve serious. He has done nothln _ .
ry g repllbllcan exertion and awaken enthusr N0. 2 dld as he was told’ When No. 1 calladattoegch and all of said amendments and alter. MUSIC. Atastc for Classical Compositions will be

 

 

 

 

 

where the regiment was engaged on the _
' tand avalnst . . - . .
first day’s fight at Gettysburg. 00119111.]“0. taken a firm 9 ° . to deserve such a reward as the PleSl‘ asm in the other states for the November - - - . 80; h 1, l l 1 1 1 th r r e cultivated, and regular and refui ll - ‘ ' '
When new business was brought up a furnishing liquors and wmes to hospital dency, the greatest in the gift of the battle _ Stepped behmdaconvementIfrelght cal. 333,13,bgggegggkglggmfig‘o,ghfinsfilmgrcfij quired. None but excellent ingirumeniglifi-ecssgs. FOI' $5.00 are WOI‘th $6.00 and are SOld for that
- - - ' stewards under 're uisitlon for medicine. - - -' ' ' He was as rugged and duty as the puny and that said Company has done acts in pur— 80 that the ear and touch of the learner may not be ‘
petltlon which had been sent to Governor “ q . American people. With such a candidate _____4+,_____, ave e of his clas H' h h _ mange ,hmoh , impaired. . elsewhere
' - In a letter to Surgeon General Bissell, - ' '1‘ m rag 5' 13 at “‘1 proba- WM. 0. STREET, President, Once amonth,an eveningisdevoted to Musical ' ~
Waller for reglmental flags to be presented . . G l defeat 13 better for the party than success. no 0 cial Code. bly done duty on the top of a stick in GEO. RI COWLEs, secretary. and mam, exercises. The puphs play in the - ,,
bythe stateto the veteran regiments which under date 0f Illle 19th lDSt-r eneIra Defeat with Horace Greeley in 1872 was The new military code which his just some cornfield. Pulling from beneath ‘ Dated, Norwalk, “3' 23‘1'1334' 2:35 i’h‘éii’ilfe Thrill: libilbcilerli smaems’ aim ilmfew ‘ , ~ ' ,1 3 '
had surrendered their battle flags to the Couch, after notmg that Iseveral reqlfls" better for the democracy than success made its appearance in a neat handbook his coat a piece of cardboard that had a ting “"lblll‘m and. 0f gilCOTrgnggnggfldzbceng men s Gall-f Boats ' - $2000 and up. ‘
state when mustered out of service, was trons call “for brandy, Wh‘SIkey and wmc, would have been; the party is in a better of 468 pages contains all information railway advertisement on one side- and . “ 911 “3 t0 fonndlscrinillhgting habits of criticism. ‘ ‘ _ “ _/../ I
read. The reply from Governor Waller writes: The governor ‘9 opposed to condition to-day than it could have been necessary for military men. These books . - ' - - ' -. Sta a, ' - - . “ "
. . . that was white on the other he slashed General instructlons in Drnwln are n cn and .
- havm such so her; furn shed b the - - - - ’ 4‘ V ‘H EQT g g y' . '
was also read and the matter left in the g DP 1 y . had it elected Greeley then. Defeat With were sent yesterday to every commission its corners of with an old pockehhnife 1 OR 1 E B k -- friiggo‘hgalfifi'l be We“ ~n la , t h’, u. ' .
hands of a committee. state. He may have heard rumors that 1‘ Grover Cleveland in 1884 will be better ofilcer in the national guard. The book and cut a scollop in one end. A piece of 0‘33“". Dlengv Olll 1’8 “lung, Taggrpéglgrglyiind LOW Shoes ' 1 00 “ “
General Noble then presented a solid was ”OE an uncommon flung f0” oflicers for the party than success with him * * is divided into twenty-nine articles, each white paper came from one of his " I {ngallg‘ilfi”3:3"ghsgglgfifiggivhsgnkgsfigg - , . '
gold badge to Private George S. rdy of and Elle“ friends to vmt Ithe ItentIof the We desire the nomination of Samuel J. of which is subdivided, and the sub- pockets. The cardboard, white side out EmbrOldel‘Y- ' ' \ Ladles Button ~. - l 00 “ “
Company C, on behalf of the in bers of llOSletal steward and there imbibe liquors Randall; we would have supported headings are grouped directly beneath the was slipped under his dirty vest, the; Alar e wPlillllilllll DEPARTMENT. . » “ , .I . , s
that company, in recognition of his son f‘lmleed by the state ostensibly ff” med- Thomas F. Bayard with all our might; title of the chapter at. the beginning. This scallop just fitfing his neck. The piece flxmreg. is Sgtialilirteidolxlllfln‘igfigtblicililg‘b'yflig Sllppers Willi Silllii leather soles 25 ’
' vices 88 a. 'member 0f the Gettysburg 10‘9“} phrposes. If you inform ““5 om“ we should have rejoiced at the nomination arrangement renders it easy to immedi— of paper was deftly folded and the cor- o idliirtfiec‘tvét”in‘§$§ ”‘Sfitfilzfidhrpiffiezegg o - ' ‘ . , ' ’ .
Memorial Tablet Committee. The badge that ll' ‘5 absolutely necessary for some of , Mr. Hendricks; but we protested ately turn to anyrequired subject. Rules' nets clipped and placed around his ' ‘ {apmdfonr to ten yearsof age willbereceivedin Ghllds, LOW Button Shoes 25
was gratefully received and responded to l‘lbd 0f aIstlmulantIto beIfurmshed, stat- against Cleveland as an undeserving of military'courtesy are given under the 816% neck. Two pins fastened the GO TO "J 8110511felliillillligllliiinkggvllgdggyalaniiigivrmxgiiuiguggli ‘ ' '
inafew neat and appropriate remarks. 'mg the lfmd’. I "WI“ so 111me the com- candidate. We meant 'it then and we head of discipline. Junior oflicers are paper to ,the card-board. Two more . I fidttii'tflfi‘glfigghbhfltfwggggfifi,$33: EH ‘9 . - ‘ .
President Lounsburythe‘rlcalled Colonel mandemmchlef. . _ mean it now. ' required to make the first salute. A fixed the card-board firmly under. the Tlieilitionnd capecmuy imam“ and pmflmmem GHStom ark and Repalmng a Specmit
Allen to the stage and said at he had Surgeon General Bissell entirely agrees I -——‘—‘*>—'-—" . ’ mounted ofiicer dismounts before address- vest. J ust than \the through train came 4 > a mine,‘eé’é‘féflly’el‘ngxéfifffiéfifiiefllg’3m; _ y.
been selected by his comm es of the WllllIhls superior that whatever stimu- State Central Committee. ing a superior officer not mounted. in. The dinner gong rattled on the 'B L A C 1<M A N S ba'iii‘illegilggggspl‘ilrtlfg 31':de w‘iilyb: 01lk‘nd il Trunks Satchels Leather nd Fin
Seventeenth Connecticut to perform a hint 18 furnlshed by the state should be . The members of the republican state When an ofiicerentersaroom where there platform. Over the steps of a coach “two “1 "19 mOmmE “lid Oneln thea 0:001er L, ' A a dings'
very pleasant duty. 'He then proceeded “59d 301;? a: ugliiflIcme, and not as a bev- central committee met in New Haven, are soldiers 311 the latter arise, remain from behind the freight car came Mr , . gighbililgcehtmes’ 9‘ team“ wm be “1 constant . . -
' _ era e.—— artor limes. » Tuesda aft . Ho;H B.Ha- - - - - - r ' ' - ~ - Th lil E:l iG-E:NE: B A [q OH E:R
1n well chosen words to present to the g , . . Y 191110011 t nTh ling 1' stnndlng 1n the positron of the SOIdIer Tramp-I HISI mother wouldnt have N0. 11 Mall St. Norwalk, 001ml tembgrsfothasii‘bpyllegaxtlldfigfg::(llm‘Ilvsgibliiesgflypllsrfill: L ‘.
Colonelamagnlficent regimental badge as W “3011 was 3 5° presen - e 0 Y mem. wrthout saluting, and unless addressed, recognized him. He was bareheaded. “10“” be made PTBVlO‘IBtO "'8 0119mm! 01? the - . ‘ ,
a token of love and esteem which the '1‘“ “mm 11““ “3“?“le ber absent was John G. Edmonds of Deep preserve silence until the officer leaves the His shirt front was glossy white. His film‘s For terms and mm” ’mommon' 17 Main. Street, Norwalk.
members of the Seventeenth Regiment The Veteran Naval assocratlon 0‘ COP’ River. The meeting was called to order room. The articlerelating to equipment collar was the cleanest seen there that ‘ Miss N- P- 3AM, hlnclpbl- ' ' ‘SwinSwo-Js
hear him. as well 35 their appreciation 0‘ nectlcut wm have a reunion at Savm at half past two (“look at the New Haven- prescribes the arms, dress and color to be day- ‘ He had left his old hat behind. . ‘- » . _ .
the interest Wthb he has always mani— ROCk’ Wednesday, September 1'? Ab HousesIby Charles J' 0018 Of Haflfofd’ used by the Connecticut National Guard. -HB 100]!“ nearly as respectable” ally FOR SALE, D F 't h! ‘ '
tested in the association, more especially mngements have been made for fee re- the 01111111112111 19'“ year‘ Allen W. Palge Watch guards, chains or seals must, not be 0f the passengers With whom be rushed A STYLISH , r. I C s ‘

at 1 ovclock, the cost per plate being $1. tary. Hon. Lynde Harrison was chosen but badges ofthesocietyofthe Cincinnati, could not be mn by the_ waiters.

response, in which he assured 'his com- I
"Here, put these two plates of cold Newly Trimmed and Painted. , ' w“, commence m,

 

rades that he would ever cherish the Suitable badges Will befurnished bY Vice- chairman by unanimous vote. The elec- the Military order of the Loyal Legion and

in the matter of the Gettysburg Memorial film tickets over the mIain line and all of Danbury, previously elected temporary ‘exposed on the drag Neck-ties, other for the lunch-room. At the counter his - , - I _ -
Tablet, . Colonel Allen made a fitting its branches. The collation Willbeserved secretary, performed the duties of score. than plain black 0,. white, are prohibited; ragged pants and clay-covered shoes _v I C T o R l A _’ F adlllly and} 231,13 561100] for 1884 I For Rum“ Pflml '1884 J T PRU II]-
‘ . . ' ' s ' I I ' ‘n,

 

 

 

 

kindly affection which prompted this PFBSldent Wells, of New Haven, at the tion ofapermanentsccretarywasdcferred the Grand Arm of the Re ublic and chicken, them 'sandvitches an’a couple .. . ‘- -

present. . depot ofthat city. Provisronwillbe made until the next meeting. New Haven was others indicating ayctual service'pin the field 0’ coffees on a my; quick new! " he ~ A Fine Family Carr rage. . ' Seventeenth Year,

The badge is of gold, about four inches 301‘ the wrves and Ifamllles 0f vegeransgf 88180th 83 headquarters 0f the 00mm“, may be worn upon the left breast of the. shouted; “got to go way back to the Will be sold at a very low price. 0N GRAND EXCURSIONS I I

in length and one inch wide. It is sus- “6 nOtice is given to Vice- resident and the chairman was authorized to hold dress coat. Several articles are devoted sleeper with ’em.’.' Afew minutes later . ,, - . , _ , ’ ?.
pended from 9. Lieutenant 0010“le Wells. The executive committee consists meetings in New Haven or Hartford at to the duties of soldiers in camp or in two tramps were enjoying a snug lunch HENRY TILLY! MONDAY, SEPTEMBER 8 To THE _ 47 Main Street
shoulder strap and upon five parallel gold of A. A. Cluff of New Haven, 13'. A. John-I lus discretion. I garrison and on guard. An article on behind the water tank. “I say. pard. 0 AR R | AG E M A KE R, Circulars, with full particulars on application to , ' . .. . . _ a
bars in letters of blue enamel are the names 1 son, of New Britain, 11- 13- Gillette. 0f ch 3' 'o-n' .t, - military honors or obligations prescribes hows that foragame, anyhow! ’ chuck- SOUTH NORWALI’ ligfinm‘clpal’ DBJ'C'F won. r] 0]] fl 8 as I

M the engagements in WhiCh the COMM] Hartford, W’ 0' Staples, Of Westport and The democratic canvass is seriously salutes. The salute for the president is led th° one with “’9 snowy bosom; ' "‘ ' ’

, _ ., . . . . . . u . , . . '. . . . . .
pail'ltiiclilpatttlld. b '(Ii‘he elf'ezlltlaeng‘pf :egcnanlei William White of Menden, embarrassed by the doubt which still made with all standards and colors drop- wgmorilggn p321: 0:11 (:1?le 1f yer want . . , ON AND- AFTER I AGENT EFOR’
(W c 15 e a $90 8 I" ”191031: W“ 3. ed exists as to Cleveland’s withdrawal. The pins. careers and troops saluting and ..__...,..r .._...._..._‘ TAINTOR S Valuable Property for Sale. - . . r - : .. .
Eleventh Corps,) is studded wrth dla- D . 'h 1 t lmnth N‘ - h . 1: religious press, which so heartily enddrsed bands, trumpets or field milsic sounding , gum NAMES. . . - BE Hemestead of the Me John W. Taylor s d J 9
monds “0 under that hangs the Tenth C “’ng ’ e a evgr .? mt regimelli ’ the democratic candidate before they knew the president’s march. The governor 0* ‘ ‘ "‘7' . V -- OOKS ldeceasfid’ m the liltirililgetrmtwiitpm’ WM: F un ay’ une 1’ 84
Corps badge, ofblueenamel and gold, wrth ' V., m a fight “1 oulslana captured t ‘8 him, now with substantial unanimit do. the state receives the same Wltll the ex- . Perhaps the strangest feature in the i o :giadlingigvatgiitugoiiilu coniailel: '13 fobifisslir‘idl ‘ .- .

y

 

 

 

 

 

the figures “17" in diamonds. - colors of the ‘T hirdMississippi Confederate . . . . . . h 1111’ whole history of ohfistonings in the fact ., . large attic and cellar broad piazzas and a never I ' l
‘ mand his Withdrawal - and this demand ceptlol l that the nitrate Bounds t e gene 3- . . J h a lace describe Cltles.Towns and Stations - ’ - Y Y -
‘ ’ that parents :11 humble life should have onqthisgouiles, giving items of interest to the tram galllllfi)ew‘?laga emittgl‘i'e 3233? too! shaélc treecsé EVER DA a . ' ‘ ‘i

The business of the meeting then pro- . regiment and sent the same to this state. m , . ,
. .. sets the Views of some of the regular march. Several chapters fOllOW 031mb- .
The colors we laced n the ca tol at . . - - - . ' eler- . - f tn ti ro ert trontin on t at t . . 1 . , . .
opedegIan; ti}; filiging 0309?? “'13” Hartford forsaffikpeepiugl At the rgbnion party organs. Mr. Cleveland, being m tary tactics and technicalitles, including mam]? at a 1051;? “$6: ‘51“ name Illustrated withMaps and Woodcuts. grime gnlali‘gcpprgporilon of thgpurchiiéis erSfeys Illle bate and l‘ast-Smhng Steamer '
e co e - 1‘63! en 1 enry “59 1 Vice. ' the wilds of the Adirondacks, may not the dutles of staff officers. ' Complete m- or ° W brano ' e 0113‘ ex. Prwe' , 25 cents each, by Mail. ggnggssfnggg’gg‘ilfnvt‘refigflrfib‘isnhidd'essldii‘

penance has proved that one Of the City ofNew York. Describingthe Publchuild-

STRICT 0F ‘NORWALK, ss. Probate Court, F . E . P I N A , BENDING 00‘

presidents, Company A, W. O. Merritt; 0f the “Ninth” fit SavinRock ii was voted have heard of the movement looking to structiou for nearly every possible military

B, Edwm Harrllson;BC,1Thomas McCor- 2‘; :fiiugllligls‘izglofi?:fiemrvrgfifigflfiss his withdrawal. Meantime so seriously movement, 01‘ emergency! 101‘ bOlll blllcerfi £22311? methods“? grgtlmntgha 11311181; {fifisoni‘iilkitfiir‘l‘rfifi’ielitif'i'tii’3R3.Pli'li’omrii‘liéi; DI t m A D 18“
“e“; 1” SW J' ‘“ °“" E’ Gm“ ,, g ,. y is Me Hendricks am“ by theme” “mime“ WW ‘°“"d i“ “‘6 “W ”3““- ..u..° if” f- 1.13.? “viii if. a2':lists“l.assessment:learners raccoons-mo...storms... -
' 8 0 0118 W 10 09' 95 8 " ’ - . ' ’ ' in said District deceased. , .
R’s, Omnibus Routes, HuckFares, Ferries, Street The Court of’Probate for.the District of Norwalk Capt. “‘ H‘ Ii. CLARK‘ Commander.

Hale; F, Theodore Brush; G. D. S. Bar. can be obtained from the state authorities. for M , . . - - .
- I . . r.. Cleveland 5 Withdrawal that he tlons of the Connecticut National Guard. ._ I _ , .
tram ll H’ Thomas P' Cave; 1’ James To carry the resolutionlnto effect the mat- Writes a letter insisting that he ought not Appended t0 the new book is a n0te relat- eye' This pm“ 18 supposed to ac- ¥$§lew and Church Directories, audMap ofNew hath limited and allowed six months from the date _ W l .
count for the prevalenceof Joshuas. Se. Shh 3.50m. The Atlantic Coast from the hereof for the Creditors of said Estate to exhibit Will Leave South Norwalk Steamboat 01’ B R I DG E PORT.

 

Wright; K, Frederick McKay; secretary, ter was left to the executive committee of . . . - ,
. , . . o w hdraw a e 1 luv to the late Colonel Crofut 8 character . . _ . . . .
G. W. Kceler; treasurer, Patrick Wade. which ColonelJohn G. Healeyls chairman. ilopelthst he,m:ydn:yery r pub lean wrll 38:8 gentleman and soldier. Samuels and ““0595 in country Villages, Sthlamgngmtggnlg‘ISS‘ltsétl’iEm to West point, 3:5i‘efii‘il‘flzirfgiéfiiiigfigterl'i'iiieerl'eli?,$‘§§}32253 Dock for Roton Pomt as follows:
The executive committee, which were The committee. if they secure the colors. . ____..'.______ ' _—+»—-———- as compared with much more euphoni— eatsmlnounwgs.shim,'{gohgggstgssggnm 3mg}; fighlggdggsgmgh, film, 3;: Susana—2, 4 and (i p m Rarur‘vmo '
' ' ’ ° - - a n so oun— . ' ‘ ' '- .

, announced later, are: Col. Henry Alien, Will take them to New Orleans sometlme Well, We Should say So. Notice to Advertisers- _ ous Bible names which do 110* {lPPf’M' figfififigéfi :nd aligned via. Hudson River diste payment to Slims P. Tghmh. s—Will Leave Roton Point at 3, 5 and 7:30 A FUII LINE .

c, F. Loomis Levi Dixon and Geor e 5 during the present fall or winter. Those who know P. c. Lounsbury under- From and all" to-day Changes In ad at the head oftho page. The devrce has Steamers and Railroads. , 3&35 00“ 0"- orl tor .f a" e bl t t' O]:

’ g ' i stand how foolishly iaise are the re rts that v rtiscments no‘w runnin i the GAZ ' ' ' 8"“ ' "l““l‘le‘l- The “Elmsa‘ude °‘ 5"" ~ '- p. m., 1" l are a e 0 par 189'
Purdy. . —————<§>——-—- he will not give “cordial Imp on whim me. e I g 11 am also led to some curious mistakes, such may, rings, Describing Springs, Boarding- manner or NORWALK,ss., Probate Court, .
An adjournment was then made to the Oincers of Veteran Associations. 0mm competitor for the g“ émmml nomi- must be handed in at the office ‘by 81mm as that of the man who, having called his iii-i153? emollilfapglg \lhlgheéiiiilfiiilgmvstloxgggi EstafiugggggghQ-ADS-flffi‘m law 0, Norwalk Steamer wrll leave South Norwalk week
nation.—New London Day. , day morning of each week. 'Unless this is first four sons by the name of the four antagonism! Waters: now to use them. By in said Dlsmct. deceased. ’ days “5 fOllOWS =—10 3- m!» 1’3. 5 “ml Wheels
‘ Dr. 0. W. SflLLXAN M. D The Court of Probate for the District of Norwallr, 7 l‘ m . R eturninir will leave Rates 5
.. . .-. .

grove in the grounds of P. C. Lounsbury The officers chosen by the Fifteenth . . .
Those who know anything about Mr. done advertisements cannot be changed Evangehsts, presenwd the fifth to the E", mm, ho. ., Néw You): to Ithaca, Ha- ha", hmhea and allowed six months from the date

Rochester, Dunkirk, Bunnie, hereof for the Creditors of said Estate to exhibit Point as fonows ;_11 a, “1.33.4. O. and

 

 

 

 

 

 

 

 

 

 

whereanumber of long tables had been C. V. at their reunion at North Haven I _ . , . . . I I
placed and upon which was an abundance were l—President, Capt. M. A. Buttricks; Lounsbury 5 high, honorable and manly till the followmg week. New advertise- person with a request _to name him xggafiggrfiifilfih mm mm“, and bran chm the“ claims for ”Meme“ Those who neglect to .
of luxuries in which the veterans and 'Vice-Prefildenlr W- S- 398011”; “Emory, Chfmcm know “mine 18 the 19‘“ man to men“ will be "New“ up to 11 a' m" 0" "'Acts." “Sufi-0" ”felting *0 b00103 New York in Sal-mil “will“ 5 film, ”"3? present their accounts, roperiy attested, within 9 p. m., or later if agreeable to parties. 5.1301698,
their friends made sad havoc. About an R C. Rand;cilaplain. Rev. .113. Doolittle; “Bulk" °’ “"1 “d‘sgmnflf‘l'” ”mm “mm“? 0‘9““ “’89“- ‘ 4 3°! a hint of. “1‘9 9°“ 11” 0153“an .fioflt‘fiié‘eri‘lii'kd‘v‘nidbéifiu illii'vir. “‘ diiiifiii’duéfiidfiiflfiariliailaiiiolfiillliisi’rfil. . '. ' i . ‘
hour was consumed in the “contempla. surgeon, Willis Benedict; historian, Capt. another “‘0'“ “'0le republlcan hasborne W" someotillmore quaint attemptsbased on Boga; figgghrfilhgmyngggfik 1&3, film: gag-gum mymlmll" B “\STili‘iE‘da Ellillmflll T1813“ URI] 25 can“ l Rims, ‘ .
tion“ of the repast, after which music by George M. White. It was voted to hold 05 the honors 1“” hands lladIfondly Suits Everybody. , an orthodox though ignorant desire to ”mug“ of Newport and tn, ewgeitriliiiyéo me - .. .. . . .
the band and speeches were in order. thé next reunion at or near NewHaven. “geld blvoil‘ldIIICWSCb l°_ lllllm- .1313? 1“; All over the country the nomination of perpetuate the name of an ancestor. It fife-{tedill'iihiisi'drd N‘I’fl’f'gna N. n. and con... rsrnloggphnpngvhgms. Probate Coun‘ Great reductio , in prices this mason . .

'An ample Staging hall been “meted 0“ Those Chosen by the Twentiem 0‘ V' at Y 0 e If 6:” am3 uh“? E-WI ' 0“: Theodore 1" W0018ey’ the “inflame and will? that honest cal-mt?- £01k: om?”- Riggtll‘érll‘l‘llemns. pouch to the White Moan. Estai‘ci‘giliours’s iri‘lSH' late at Miles City, Everything first-class. Shore Dinners , Bows,
theatreetowositethe Mummers”, mg“ W mermaid” W- W' ‘“ “‘8 1 ”lg “ "i l“ ”w". .. We“ We“ m We “were “a “‘8 E m” H" W" ”mm“ “ was me Memvmrml stateside“ “slums straits“ll:rssa....m.. oulv 75 so... soon... also. and .ll

- r o o . ' r . , ' I n ‘ . L . . . . .
upon Wthh were the Meeler and Wilson Smith 0f Seymour; vrce~prcsrdents, R‘ the successfu nominees (3 t Tc republican the head or the republican electoral “ck“ book 0f . than. mimndfathem have C'iifffii‘iiikgiflbfiildfg‘ifin New York iind hath limited and allowed six months from the date delicacies oi' the season.' Clam Roasts u Shafts, &c.
- 1 H Paddock of Brid apart and S. E. Chafiee Pally 0‘ the Slate and “mom - . eaiis forth universal commendation ‘~ - taken their young hopeful uP '30 the font Philadelphia to Bethlehem Delaware Water Gap, her-ear for the Creditors of. said. Estate to exhibit _
band and the V3110“! speakers. 00 - “93- , _ g ’ . _—.————<+.-———‘- , . .. . , ‘ ' with theintentionof havin him be tized Munch chunk, scrumon, \vllllhmsport, and Elmira, their claims for settlement. Those who neglect to specialty, only 25 cents. .
introduced Judge Corvcll, of Waterbury, 0f Birmmgham; secretary and treasurer, Brains and Beef. If it is billions headache that trouble u u . . ,, u . . ,, g p , New York toPhiladelphia,.lisltilaoreand wash. presenlgIthehnlaggohlléghpergpgrhefcgtgslgdrAvlliithin .
- Alonzo Smith of Cheshire. Five hundred rm .9 h a a d't ~ 10 Tild - ° 3° - Inbm or 1311er sndsllhoush re- inston- . , . said i e, -- ’5" P"- - Intoxicatin M k
who made the opening address Then d n d f I G b w “7‘ e“ 9 “n e “m“ n 9“ grafted nevergotrouyleddby agothgogttltscké fund to “convinced that the original Sent,porlpald,omrremlofaa cents each. , fonsigldggteg figggfstate are requestedtomakc Positively no 8 . l! 8 Constantly on hand
0 are were raise or he ett 5 ur “T1 of r ' 3 en 0 our huggis‘ an e a e 0' ~. . - mme a p - -

foll°wed SPeeCl‘es by W 3- GM" 0‘ y g and Cleveland’ ‘8 m“ b “m and Palmer’s lltlegPllls; they will permanently owner of the book was not so christened. 'Tillllill‘ Bl'flsq‘lliil'l'lil 81 00., PililllSllfll‘S. 3,35 JOSEPH %,§n‘},§,l{%,‘§’5,I‘ sold on Sunday. ~ - .--- 7,“

Fairflcld, ““9. Rufus F. Pickett Of New monument. the man of beef.’I’ cure you. . 18 and 20 Astor Place, New York.

0‘ \

 

 

l

U

Loading scan from the Connecticut Digital Archive…
100% · drag to pan, double-click to zoom
page scan