,We‘r swam
”inasmuch-pasta.
bl the We, to the Harwell
as...“ of Westport. on night,
“ Mindinthsdesthotonscftbs
in thesvsnlng e trio of young
ward Warren, Charles Allen and
Stimson, went to Grey’s Creek
duck shooting expedition. They
about 10 o’clock to return to
, homes, and were passing along the
way in front of Horace Wakeman’s
f , at Compc, when the triggersof
shotgun. so Allen, who was carrying
“I. Film, says, must have caught‘ on
the large buttons of his coat. Both bar-
.werc“ instantly discharged, the con-
bnoterlng Warren’s left thigh. Bis
we friends rushed to his assistance and
carried him into Mr. Wakeman’s house.
If! (”interned b‘tudaged the woued‘es
she, could, stopping the flow of
. V , ,and a messenger was sent for Dr.J.
Fife. When the doctor arrived he said
would be necessary to send the injured
in the Norwelk hospital. Ir.Wake-
‘plenharnc-sdhishorsetoanopen
'gssgon, Werrsn was placed in the vehicle,
ind in company with Allen, Silas Good-
eud Ir. Wekernau, a start was made
,, Norwelk st 8 o’clock this morning.
‘ 3 it was about 5: o'clock when the party
. ‘ Ofllcera Gladstone end Penning-
ton on the Washington street crossing,
fad were directed .to Solmans' livery
htsble. They had just driven into the car-
riage way, endless of the men commen-
cad talking to!i Charles W. Seymour, the
lit men, w on W rren suddenly fell
. .. hackwer sin t e wagon. Mr. Sey-
. ~ It hastily Enmmoned Dr. L. M, Allen,
gho respond d promptly and worked
I, sroically 0; er the inanimate form of
£. area, but all efforts to resuscitate
’ ; us were fruitless. The physician’s
“pinion w that deith was instantan-
, icons. ical Examiner W. (l. Burke,
31.. was , 0 called and made an investi-
gation/Coroner Deten, of Bridgeport,
‘bntifisd of the all'air,end arrived
. “the 11:37 train. Be at once pro.
' with an examination. The wir-
totsstlfy were Charles Bettcraon.
, . ,. Alla, Horace S. Wekcman and
{f l Burke. From the evidence given,
NW at once decided that the
. mm,spcmnl,snd that death
' “led from hemorrhages. Warren’s
‘ thigh was literally torn to pieces, the
v. wound being large enough to insert e
' man‘s hand.
Thcbody of Warren was removed to
H. S. Gregory's undertaking rooms, and
' prupsgedfor burial. Warren was about
eighteen years of age, the son of Mr. and
Ira. Eugene Warren.
The oilieers took Allen into custody
and placed him in the lockup, thinking it
would be well to further investigate hie
story. He weseeen bye Sam-rem. re-
porter this morning, end the above facts
g aressherelsted them.
2
l
“ P30! AN ABII OFFICER.
Avsrell's Report Concerning the
Heroine lune.
. : annual report of Gen. William W.
l, of the United States Army, con-
thc Connecticut Soldiers' Home
. iloroton. besjust been submitted to
at .William B. Franklin, president of
. hoardof managers of the National
m On August l, 1894,
were 348 veterans on the rolls. Fif-
ty~fourwsreshsent on leave and any.
aluswsrssiek. General Averill think.
A
couldnmnecsssmlflovolveaiargtex.
press. 'l'hspsasrelregrststhsshssees
“lookallcthebarrscksfortksstcrage
at the personal scents snd clothing
'cftksmsa. Tksprmsctmsthodmssts
monotone-toured". BO Irr-
itisasbseo-les Inch I Mills
Che-l at that at Ncroion. ”no
”mute-mun» seat
mistresses-stomach
.tmutksaadweswcicssis.“
:Wwithssshlccrnseslrsaasssrsl
worth going to see.
reroute senses
Bludlvr appeared at the Muse- lest
m in g M M m WWI-mummm.
'Tuggphln'puug' “Mb“ Mamet Kaleidoscopic Beauty. ' ’
petulant! WWW“ vamflhmm Mawdhhnohcrmlusoelsl
mountains. Themlluupam mwstssotran-Iolcsul'lw-In- west. ‘lhs lerrsll measles icons of
harelcslsmset,w sppselsstrocg- slain y WNW tkckasilsoutsst
ly to lovers“ when. It is well “1:, m 3.31””
played. Ilse Biodlsy was srsstly aided
by tbssxcsllent mung of writer Horton
as the first ‘cflcer of the steamship Alba.
true." “The Captain’s lists” will be pre-
sarted st Hoyt's Opera House, nest Iou~
day night.
The Mathews Comedy and Mikado Tea
company opened a two weeks’ engage-
ment in Music Hall, last night.
programme was an excellent one, con-
sisting, last night,of specialties. James
T. Crowley is an excellentzDutcb comes
dian; Thomas Levaniou displayed great
dexterity as a club swinger, his performo
eucc with the live clubs being really
wonderful: George C. Lydsr is a funny
comedian. and took well with the endi-
cnce; Charles F. Ed rerdl, the black
artist. did several very clever sketches.
The most enjoyable performance was the
contortion and balancing acts of aJsp-
ansse, said to he the smallest performer
in the world. He was muted by his
brother. He is really a marvel and well
The entertainment
concluded with a humorous one-act farce
which will be changed every night. Ir.
Iathews gave a brief but very interest'
ing lecture on the merits of the tee, and
a good quantity was disposed of. Owing
to delays on the railroad the decorations
did not arrive, but are expected today,
and the ball will be converted into a
veritable Japanae village.
tlemen cf the torn.
Theatre. tonight.
qllll'Pl'.
Hartford Courant.
Ifr. Belknsp’s mommime,
exquisite mimicry
tall, and it was all done with
accompaniment; March 27.
miseellamous programme.
I". J. Schenck, who will also
place. A full memacsmsut
authe‘lllOtruhlo vflt
afternoon a tea party .will be given by
the management to the ladies and grew
The entertainment
is free to all over twenty-one years of age
until 8 o‘clock each night. after which
an admission fee of tin cents is charged.
Testimonials to artists engaged for the
Club Union entertainmmt at. lloyt's
Harvey Loomis' work stamped him as
a musician or much ability with a prom-
ising future before him —thchlleld Bu-
blr. lnomis began with a l
speech in pantomime that etc y sent
his audience into roars of lanahter.
morons monologues. which suited to per-
faction the speaker’s lmpcrturbebly and
comically grave countenance, kept the
listeners in continuous msrriment,—-
of manner it
Belknap. was marvelously clear a de-
ing grace and delicacy that was without
reproach —Waterbury American.
Charles F. Underhlll proposes to give
esuhscription series of three recitals at
cht‘s Opera House, South Norwalk, on
the evenings of March 13, Iaruh 27 and
April 9. The programmes will be as fol—
lows: March 13, Shakespeare’s "A Mid-
summer Night‘s Dream, with musical
great comedy, "The Rivalsz" April 9th. 3
mission will he fifty cents, and the sub-
scription p.ice will be “.50 for two
course tickets. Subscriptions will be so-
licited by Mr. Underhlll’s advance agent,
course tickets to subscribers prior to the
opening date; but no collections will he
made until after the first recital.
Underhill is no stranger in this city, bav‘
lug appeared many times under the sus-
pices of the ifutusl improvement society
during the years when that organic ltiou
supported a course of high class enter-
tainments. it is hoped that the remem~
bronco of his work in the past will be a
sufficient guarantee of the excellence of
the proposed series. A similar course is
now under way at Port Cit-tor, where
Ir. Underhtil gave " A Iidsummsr.
Night's Dream” last week before an an.
discos that received hire most cordially.
Thsrsceo benctblng dusrlu enyoas’srs-
perlolrs then this Shakespeare“ master-
‘ scum 110R
" lllllt’s llSWE
It was
sxccptloutotberuls.
its kind given in some time.
The
much credit upon those who
eighth deuce, shortly before
time insbeppy manner. A
tendaucs, and two of the
Thursday
l/Juis Richards, with guitar,
number of very exquisite
cslly enmred
crate decorations. but the
liticel orchestra,
Eur
was master of ceremonies.
as w“ in conducted.
Ir.
a bewitchr
Schpub, 81., T. Eophrst, C.
Sheridan's
Single ad-
deliver the
Ir.
berstoforvmucholdsr lieu
-—ect yet tweatyoes-vthoss
in circular
lug law.
Alumnae-asses.
York secs—r.
, WW”W~..MW ....
useswful, and the WWW
tenth annual mu ball, which we Moduli-hr relevant thou-noon
plmleuulghtintheeoolcty's well sp'
pnintsdhall on “iron structures on
largest-ad most sociable gatherings of
was-taxed almost to its capacity, the door
containing about as many deem as it
wesioly could. All,of course, were to
customs, vsried,and in many instances
very pretty. About every thing imaginable
was represented in the throng, but title
only afforded greater pleasure.
The grand march was led by the ii .or
committee, James 1'. Thompson, Charles
(kick, George bchssr, Joseph
Charles Farrlngton and Walter Hell.
They were Windy attired es Fenian
nobleman, and crested much edme
tion. Themarch included considerable
intricate mauceuverlug, which reflected
ed. About iifty cJuples followed the
committee. At the conclusion of the
masks were taken off, and, as usual
there were many surprises, agreeable and
otherwise. The rsfrsshmsntand lunch
room was located down stairs, where the
merry masquerade" spent considerable
from the Bridgeport society was in at:
Toby Delfiirc, with mandolin, and
while lint Wheeler favored with vocsl
numbers, all of which were enthusiasti'
There were no new or strikingly clabc
stripes adorned conspicuous places about
the hall, end gave additional coloring
and brillanoy to the kelridoscoplc scene.
About two hundred spectators watched
the dancers from thebclcooy. Thelargc
which furnished excellent
music, wasnnder the direcuon of Pro-
fcsscrAlhsrt Brine, and Charles cht
mittccssnd members deserve greet praise
for the manner lu'wblch the affair was
The errsngcmcntcommlttec was Chris.
league, ex‘odldo, Herman Islam flan-
ry l’roeb, Jacob Mano, George lehaub,
J. l". “canyon, and the reception com-
mittee consisted of (instavlacgsJoseph
Volk, C. Swans. W. Wehls,
P. Francis, B B Burchard, l) 8. Bar»
ker, ll. IcDoceld, J.‘ ll Ferris. John
Belz.Johu Schaub.Jr., Gmrge Dufalt,
I. T. Hatch, Imot Smith, Frank Nash,
John Dahlgreu, Albin llalmo, A. Krug-
er, L Qultmen. Karl Schnuh, Edward
Concenfidrnund Crows, Charles Dimoud,
it if. Golden, Dr. J. F. Kennedy.
An [donor to One In Young.
President Edward T. Buckingham, of
the chapter of the Brotherhood of An-
drew and Philip of Olivst church,
Bridgeport, enjoys a distinction never
before conferred upon oueso young by
the Brotherhood. Ir. Buckinghammho is
a native of South liorwalk, son of Wal-
m T. Buckingham, formerly of this
city, and e nephsw of ltrbert l. 'l'ullss,
othrlen, wasmadcs memberof the
skecutivs council at the convention held
in Bridgeport lest week. The position is
one of considerable importance and
chosen forthc council. Although young
Inleeklugbellwsllssyawlss choice
hashssn-ads. fishes been encou-
gstlewcrkeriabshell of the Brother.
hood. Insertions-graduatedfrom
thsBrldppcrt lllgb school when six-
formwillhspuhlbhsdletsrou, giving a ”"' It": m 3%”:
mummm,masroue “m” '
slistofthssuhaeribsrstothssrrlss.
Idlnte'isitlcwlcvsu.
UmTflhu,i.0.i.I. Mlle N” hum
Wsmussssriolsmssns ”u" '
chlsf'sdsgrsecaossrissnbsyvraad
Mimi-l“ "' M.” mflp‘leaecwditsem
mamnuistnesnasn W mm
Marcus-y rem-rm
thspspwi-ityssjeysdbythelatsst
"lbs couldn’t lorry
pr-satst.
elm-Mthmlseaietsars
”W sedhwsswisgsseesbhtbsmasyuev -
. its tr; FEBRUARY 1}.
1895.
BILL ' sour sure or urn.
”if
«hesitated-tarot
Iortsll.wheisaowsllaud
known in lor'walk so
leer the Itsilrcad crossing.
in the city of Hartford.
y decorated, the prevail-
wasprs-sdlutcrsrvlcstoaconsldsrsbls
extent to produce this pretty color effect
Ifrs. Hornll and her sister, Ire. Fair-
halrn. were assisted in receiving the
many guests by a number of Hart-
ford's prettiest matrons sod girls. was
Susie Iorrell, the dcbutante‘s elder sis-
ter, also ssrlstcd in receiving. Miss
”Menus Iorrell wore sgown of white
silk with chlflon. Orchestral music dur-
log the afternoon was an innovation
that was much appreciated.
oneofthc
The hall
the . property,
Tbcfleus Cersmosis club held a very
enjoyable gathering with tiles Maud
Hoyt, Briton Bill, last night. Dancing
was indulged in until midnight to music
furnldlsd by Calvin Purdy. The msnh
hers of the club present were» Misses
Ilnnie XII-pmltehnllc and Charlotte
Bosch, Daisy Scuddsr, Bessie Lyon,
Nellie BedcllsJoulsc Wood end Iaud
Hoyt. The guests were Seymour Curtis,
William Benedict, George Fitch, Addi-
son Wheeler, Robert S. Iitchsll, Step-
hen S,Jervls and Samuel W. Hoyt. Jr.
During the evening a bountiful collation
was served.
Blown,
new building locate-vi there.
www-
midnight:
A number of members of Douglas
Fowler Post, 0. A. ll., and other friends
gave a surprise party to Clark Dickens,
of Spring street,last night, in honor of
the titty-fourth anniversary of his birth-
day. A splendid supper was served, and
sverythingpsssedoif in the most suc-
cessful manner. it was midnight when
thcgncstsdeparted. Besides the mem-
bersofDouglas Fowler Post the other
guests present were Ir. and Mrs. Cher-
les Baldwin, Mr. and lira. George Dick-
ens, of flew Haven; Misses Clara end
Lina Sterling, (lewgc Toby and Thomas
F. Dual.
delegation examination, but
numbers,
rendered a
selections,
an it.
stars and
William 2. Ashton, of Norwelk, and
Ilsa Sallie I. Bcnksl, of Brooklyn, were
hurledflthc bride's home, llli Tomp-
kins nv'snue. this aftwuoon, is the pre-
sencsdthsnsarrclativesoftheoouirso-
ting puller. Those from Norwalk wars
the groom’s mother, Its. W. E. Ashton,
Wendell Ashton and Iii- lds Ashton.
Ifr. and Ira. Ashton will enjoy a short
bridal , and upon their return will
resldsl Stamford, where Ir. Ashton
conducts a broker's adios.
Au Opponent Captured.
it is announced that Colonel B.
S lleft, president of the Bridgeport
Traction company, has been appointed
to take charge of the electric equipment
of the new York, New Haven and Bart-
ford railroad. He is now superintend-
ing the experiments on the Neutesket
brunch, where he has already set up a
1,500 horse power engine. Colonel Heft
came to Bridgeport from Pennsylvania,
two years ego, builta handsome mansion
on Park avenue, and was the head of the
capitalist who bought out the street rsil-
way system. in introducing electricity
and extending the lines, he came into
violent content with the New York, New
llsven and Hartford Railroad company,
and he recently expressed his determine-
tlon to light the road in the United
titstes Supreme Court on the question of
his right to cross the steam road tracks
at grade near the station.
fl... ..... n...— n __,
public.
Thecotn-
Connecticut.
L. Haiti, J.
Walter, B.
liquor
violating the laws.
mist him.
the red-hot stove.
Beet Bridgeport Players at Whist.
last evening, at the Seaside club, Dr.
W. 8. Baldwin and Otto Batch, of Nor-
walk, played two games of whlst with
members of the Seaside club. The Int
game played was against Blocks and
Walkersud resulted in a victory for the
gentlemen from Norwalk by a score of
antenna. in tbssscoudgamsfletch,
of ilorwek. and E. l'. Bellamof Bridge-
port, played again» Frank Ifller and
Colonsl VsnKsursn, this game ending
tlonal ch
have been
who know
but a wilderness.
exceed Kellen for the excellent game played
low cutest Issus.Illlsr and Vsnlsursu,
wkuarsssesidsrsdtbssrscktssmoftks hold them in
nemesis masons w-
playsdwbkoutlir
Udall.
is'requirsd.”
plays with ‘“
Oysters fer Ian's.
was “www.mmw the iste,wssssroilows:
“mummmmbm sour.
WWWMIIIAM“ “ml.
ares' "
mm mm
Total,
....... ttwotrofulonwiit
the funnel to be Widen-d so that 'lwc
freaks Can be bid. and ace-medians
Itetlsc so be lrssted on Water arrest
9
Among the good things promised for
Norwalk in the near future is s new rail-
way station at the Water street crossisg.
When theilcw York, New Haven end
Hartford Railroad company first contem-
plated erecting a new station Hon. E. .1,
Bill and a number of Water street busi'
ness men, offered $1,000 towards having
the site of the proposed depot at the cor-
ner between the railroad track and Water
street. At that time the company re-
ceived a favorable reply from the hor-
ottgh officials concerning the purchase 01
including Hope Hose
house, which is also owned by the city.
This site is f ivored because of its central
location and the hearty cooperation of-
fered by the business men to have the
The company are not making their
plans generally known, but from whet a
reporter could glean from those interest-
ed the company's intention is to make
the depot improvements at the same
time the tunnel changes are made-
For several days surveyors have been at
work taking measurements around the
preeentdepotend tunnel. It was given
out that t c surveys were for the pur'
pose of getting out plans for rebuilding
the tunnel. which was condemned by
the Railroad Commissioners at a recent
later developments
have brought out the above facts.
proposed, from the surveys made, to
widen the tunnel so that two tracks can
be laid and to arch it over, it it does not
raise the grade of the street too much to
The present depot has long been an
eyesore to Norwalk people and the rail-
road ollluials. When the plans of the
railroad are announced there is no doubt
that the citizens will heartily cooperate
with the company in carryingcut their
desires. The change will not only he a
big benefit to Norwalk, but will greatly
add to the convenience of the traveling
STORIES 0P TIE STATE.
It is
Items of Interest from Ivory Quarter of
The New Haven authorities are now
investigating to learn whether the New
York, New Haven and Hartford railroad
had a right to fence in custom house
square at the head of Union wharf.
The order of the railroad commissioners
at the time the bridge was built conr
nectiog State direct. and Water street is
alleged to he llOIvllEWhM faulty as to the
boundaries of the new railroad property.
Rev. B W. Jones, pastor of the Baptist
church at Stepney, announced Sunday
morning that he intended to inaugurate
a movement to stop the illegal sale of
The town ruled for no license,
but Pastor Jones said that he had the
names of a number of persons who were
He has called upon
the Suit.- Dew and Order l.eague to
The infant child of J r!” Duty, of Pine
Meadow, was sitting in a big chair when
he mother stepped out of the room a
moment.‘ The mother hearing a scream,
returned to find that thechlld had tipped
the chair over and fallen with its face on
Hands. face and
neck are terribly burned, but the child
may recover.
The new c pel of the First (lounge;
at Woodhury was dedicat-
ed Sunday. Thecbspsl cost $2,600 and
was the gift of Its. Charlotte L. Lewis.
a benevolent member of the church.
Tbesociety was organized in Btrstford
in lil‘lOeud theontgrowth icons of the
oldestsud most historical churches in
Connecticut. The society removed to
Woodbury in 1073, when the town was
(iroton people carry little nickel plated
stoves started in their pocksistokeep
them warm. A correspondent says,
“They burn thrssaudons-halfboursat
stimsfrostssbsstcfcsrbon. Lamber-
men carry tlwmlnthslrhoets,msidsns
their hands on
slab,havlsgpisye.ieeumbsrof their way to school, doctors wear
[fetch and Balls- tbs-lathslrglovssendthsgsncrelpub-
preliminaryprutloe. hemthsmforsllpnrpassswhsrsheet
themhaplflmll Thssmouatofcysters exported to
fact. lsestor'arhprsll-lsmpsfcrthswssksadingrshrusry 9.
IA nears.
H
M
ii
“summer-manure sandman mm ’ h.
‘ 'mmmv « reconstructive-rut lee. recordsd. tens.
wenllpthsfollnwlngfmthebelsls erasure or nasal arsenal , fmmmJun . WIIAT run sscrsr servers or Wholesome” ,. .
Wolf-hwy 0: “sis runs- 0mm! canons. use; Worm use, was court“ liliilllfl. , , mu. ammonia. codeine
The latter. are William, add
havens, of liberty m- , ,
ArthurStsvsuaend INMMM‘
Bridgeport: James Ebtsvsne. of“
Norwalkt Charles Stevens, of
d.
Iri.CbarleaBrlnksrhofl.ofm
These were all protein at it “may
reunion, held Christmas dsy at the
family residence.
The funeral of It. I
Stevens, who was born and had always
lived in this town, took place this
afternoon.
George W. Loder, whoss'homs was
entirely destroyed by fire, last Friday
afternoon, carried an insurance of 0800.
This will not more than half noverhb
loss, as very few articles of furniture
burned.
especially unfortunate.
1893, their eldest son, Charles W., died
at the age of twenty-five yesrs,and on
December 6th, 1894, their next son,
Frank, aged sixteen years, was found
were saved. and all their clothing was.
Mr. and Mrs. Indet- have been
On July 16,
dead on the railroad track between South
last night.
handcfonscf
yesterrley.*«
horse last evening.
ing through a snow
tonight.
Frank Clark.
recurring.
The
short distance .333.
a barbed wire fence, . .
his legs quite badly and demolishldg he
sleigh. Thepertiescameto Darleuautb'
procured another team from Liverymee
George S Bailey, and proceeded on their
journey to Stamford.
CsrlSchilcher. of New Canaan, has
purchased the blacksmith shop of Wil-
liam K. Fairbanks, and will continue the
business. Mr. Fairbanks will go to Bos-
ton. where he intends to reside.
The sociable under the auspices of the \
Epworth League. of the Methodist Epis-
copalchurcb. which was to have been
held last Thursday evening, and was
postponed on account of the weather,
will be held at the residence of Its. Ed-
ward A. Hall, this evening.
On account of the Congregational en-
tertainment in the Town Hall, Thursday
evening, Welcome Division, Sons of
Temperance, will hold their meeting this
week on Friday evening. It is expected
that the grand officers will be present.
bliss l-l‘vie Bowen was in Norwalk.
Norwalk and Roweyton.
Last October a veteran, Dr. A. I.
Porter, came to Fitch's Soldiers' Home
from Bridgeport. where he has a wife
residing. He was in poor health, but
improved, and last week he left the
Home to go to Port Jefferson, L. 1..
where he had patients.
magnetic physician, and refused all
oil'ers of medical attendance when he
was taken with a cold last Friday.
Friends with whom he was stopping,
however, dent fora physician, but Dr.
Porter died before one arrived. He
male many friends, and was very
popular whilean inmate of the Home.
The men employed by the selectmen
to break the roads so that travel could
again be resumed, finished their work
CRANBURY.
Arthur Youegs caught a runaway
lls wese
Nu services were held in the Congrega-
tional church. Sunday§evsnlng, on ec~
count of the severity Jilin weather.
Last Sunday evening two young men
were out riding, and when opposite the
residence of in Jackson, the sleigh was
upset in a large snow drift, throwing the
occupants out and severely injuring tho
horas ran a ..
mews
\
it belonged totwo
bank.
yttrssmsr IIIIIa.
Allsortsof bliissre tntroducsdlulhe
Legislature. if their subject is a little
outclthsusuelrunoflswvnakfnguays
the Bridgeport Standard. the member
whoprsssnistbs bill lsratherapttorc-
mark that his bill, or rssolctlon,ss it
mayhem presented by request. Rep-
rsasotstlvs Keefer,“ llarwelk,hssprs-
stated a biliary request,» have the
pubilcects printed in the Swadlshlsa—
gusgs. 'l‘hslatsstbilmssklng torsgu-
latathswldthoftirssupcnwsmpro-
rides that for wagons eerryiaghm
poundsths width of the tins shall be
fcurlnehss and lot over tbsebcvsss-
pscltrtirssiobslrslnchas.
m
Doriegtbstsrrlbls gels of iasthd-
useday nlgbt,theachoousr I.D. Web,
commandsdbycapiclnflall,andowusd
byblmsslfsudhllJilllatanmerldpv
tori. m is If.“ W* of His
blows from hsr anchorage. upon
thereetsassr lhssnusncs loiterwelk
harbor. or out into the local.
Imam-slimmedwhweihsm
young men who were upset while driv-
Washington Lodge will install officers
Mrs. J. If. Downsmf Bridgeport, has
returned home after a visit with Irs.
tire. E. '1'. Taylor, who has been ill, in
creatively wmeedWwiIIssspub
yartywmustsst
_ 15:1,"...1 ”u, ' ._ “.1 “’62.
“Medium“ W“ fl .
wm'wmr
Elmore Stevens. llrs.0hsrlss Bell sad v
“to“
Norwalk Chronicler