V’
B
L mammals-sum.
v
,. u on on r ‘
rusevsvrs.
x
will“
. a 70 North
_ . moooosuusroo:
, M Tormenexltodsyseverythiogtobeyoldregardloseof cost
leukemic: theFalland‘Wiuterstock. Oomeendsecure
M... St,
eourn uouwaur. or.
._ rmz’r. '
I made.
”Imam-mtmnm
“its“. MUM v
or". .
“anthem—dreams .
REW m on ml- of
see.
gatasunsevslllstsnsdtnthslrscng
sas-sdbmsmyvsryhasrtweem
”shame-invaluwlurscsl searched
Wash-ultimatum»
“and“
A» JUN
mll‘tmyhowsraormsyltb'i
i'hstltaeslate unsehslldrsltsrrse.
Datwhnlhhvuhnwithursdonebyono.
Uh. nightingal- hsva dad, and pales the
Whaaladssp mews makesmsyaotlussdor
[will phankund’ne'nlhtheh‘ ruse bundle
Matchsssmnsrandrheleavesthst made.
Whalunewuhohrayplsasshtplaeeofsbede.
MW in New York Independent.
TWO PAINTED DOORS.
It. Illnsrboardedst 8 Simpson ter-
race(thcrewssnoterrsoe.hutthe
squire thought the name sounded so-
nocuus and pleasant, so he had chrie
tmed his live little cottages “Simpson’s
terrace”). He boarded with Hrs. Chip-
ley all her two daughters, Hand and
Man, who felt it a great distinction
to be of any service, however slight. to
the pastor.
Hand gsthersdtreeh flowers for the
study table everyday. Marian setup
lstenighbtoiron andmendtable linen
sothat thegoodman mightbave a clean
napkineveryday.snd todarn his stock-
ings sothst you could not tell mended
plea. from the whole. and the little
widow herself exhausted every culinary
resource to humor his dyspepsia and to»
contrive daintydishes outof the least
po-ible foundation. To these three
simple women Rev. Milo liilner was
ilkeanembodiedsaint.
“And nowthat linlilner is safely
gouefor the dsy.” said In. Chipley.
“we'llcleanthseittingroom and white
washthewalla. BuntoDlxey's.Maud.
malnmpofunslaoked lime; and—oh.
bytbeway,bringsouuecornmeal, dear
We'll have hasty pudding for dinner
and out at the kitchen table. Borne
hestypudding and milkwilldo ferns
men.”
”Ofcourselt will do.mamms," said
"Ijustlikepuddingendmflkl‘cried
Harlan. jumping gleefully up and down,
”and. although Mr. Milner is such a
dear,goodman.yetitisasertof relief
iohsvehimgoneonceinewhile,sothat
wecenclean houseandcst hastypud-
ding and milk. 0h.landl"she whis-
to her catholic sister. as Mrs.
wentouttohang thebigkettle
mthslre."l‘vesuchan ides in my
head! If you’ll only get a littlegras.
greenpalnt, ready raised. when you are
atDixey'uandsmediumslzedhrushl"
“Greenpeiuullerianl Whatfort"
“Hush! don't let mamma hear! l‘m
uotlndofhearlngthiscalled thehouse
wlththebluedoor.”
laudobeyed. Although the elderiu
pdntolyeenahehsdlongbeenaccue
tomedtobadomineersdover bypretty
positivelerlsu.
“But it b the strangest thing,
um’m-te... fifteen or twenty
minuteslatu she handed over amys
tsrloustiueansudanoblongpaperpar-
cello hamster; "JoeDsau isout now
“Nuehalovslycolor,butesapplled
toshousadoor 1amhcartily sickofit.
JostauhesnoncrsMethenallew-
headland "
morning.
"ltmustbeulcalohavs city com-
pany, Karim.
"0h. blttothlnkof fireworks-t iti"
III-Welt!
alsocladlewhstlfsrlaeeslledhsr
WMe-dwesrl
audivs macs
Instill sndglcssyhslr.endthe
datumluedlyto
ill
1
speaktohersbontlt. lathe meantime
Imustmskogood speed if i expectto
hovemuchtime at my friend Hodgs's
Away be trudged. much comforted
and sustained as regarded his inner man.
“Joel Joel" shrieked Miss Francesca
Dean, coming into the room a few min-
utes lster. “what how you‘donel Eaten
up all the company, luncheon? Oh. you
37006 -—
“I didn't do no such thing.“ shouted
Joe from an upper room. where he was
transforming himself from an amateur
journeyman pointer to a modem tennis
player. “What are, you talking about?
“Somc one has so his till!" cried
Alisa Francesca. " not look at the
table!“
“Then it's some tramp sneaked in
through the door that i left open to dry
the paint,” bowled Joe. smiling his leg.
And while the Dean family were en-
deavorlng to repair damages the task of
housecleaning went swimmingly on at
the Chipley domicile, only two doors
away, the girls and their mother scarce-
ly taking time to sit down and eat their
hasty pudding, which. by the way. get
scorched through Maud’s overdevotion
to putting the chints curtains .at the
pastor's study windows.
But hasten so they would. the ”newly
whitewashed walla were scarcely dry,
and the furniture not yet rearranged,
when dusk descended on the scene and
Rev. Milo Miluer came in.
”Oh, take care, Mr. Milnerl" ex»
claimed Maud. “the door—tho paint is
fresh."
Mr. Milner solemnly advanced into
the area of the lampllght, and twist-
ing himself around to get at the skirts
of his coat eyed them disconsolately.
“More paint,” said he. “Blue paint!“
“No," said Marion. “Green."
The two colors were ludicrously alike
by lamplight. The green might be mis-
taken for a lively blue—the blue for a
dull green.
“Blue!“ said the pastor firmly. "Do
you think I haven't the trace! my eyes?"
“Green," Marian. “1 know.
because I put it on myself."
“It is not well." mid Rev. minor.
“for the young to be too positive."
"But truth is truth," said Maud.
”And while I‘m about it,” said Mr.
Hillier. now thoroughly exasperated. "l
deem it my duty to remonatrste with
you the extravagant and un—
warranted style of diet in which you in-
dulge during my absencel”
“I don’t know what you mean.” said
Hrs. Chipley, feebly catching her breath.
"Hasty pudding and milk can't be
called extravagance," hazarded Maud.
“Scorched at that.” murmured Mar
rien.
“Boast grouse and currant jolly," said
the pastor. “Chicken salad and sponge
cake. And—here again i trust to the
evidence of my eyesight—all set out on
your old butterfly pattern chine. I
know, because i etc of it myself."
"Yon—you got into the wrong house."
gasped land.
“it was the house with the blue door.”
serenely uttered Mr. Milner. as if this
were an incontrovertible argument.
Marian clapped her hands hyster-
lcally.
“Momma," she cried: "Hand. Ilr.
llilner was the tramp who ate up Miss
Dean's company luncheon. That was
just what Francesca Dean told me they
had prepared! And on our butterfly
china tool" .
"It was the house with the blue door.“
stubbornly replied Kr. lilner.
"But Joe been painted their door blue
today!" exclaimed Marian. ”And I
paintsdoursgreen.”
Thepastorsanklimply into a chair.
“Then,” he said. ”I've got green and
blue paint both on the skirts of my coat.
and l have made a dreadful blunder in
thebargslnl Andlmustgostoncesnd
apologise to the Dean family: but not
They until you, my kind friends. have for-
given me for my meddling interfer-
once."
"But really.” said mischievous Maud.
“hasty pudding isn't an extravagance.“
Mrs. Chlpley and Marisa hastened to
the pastor's humility, and he
went sadly to make his peace with line
l'rsaoesce Dean.
”it is kind 0' queer.” said Deacon
Philpott. talking the matter over some
days afterward. “The domiale. he
plumb admit-that he's sort o'shseut.
minded.“ needs a wife tokeephim
once.
“until Irallllnerdossuotoblect."
hsdd, with due mortssyud should
llketohsvsthe frontdoorn‘iledblua
Queen.
once more.”-
lew‘lernfssmlheoatslda.
.. have etdlsplayed. These ‘ a. new claims seeri
doctor eyeshnoweareeaabl to
Library of Bargains.
‘We simply invite inspection—amt are not compelled to buy.
. r . l i
W
v, Open evenings until 9 o'clock; Saturdays 10:30 p. m.
u
STURTEVA‘NT’S
Bargain Houses,
add another volumeto our ‘
moi :
Iostu um um All smart. tours Iosylu
IGHT” , Ill; SUIT.
BOUND WITH WHITE SILK scam,
- “‘01! '9 will I011 at see. well worth 310.00.
Come in and convince yourself.
a H.» KRIEGER,
Under Mahnckemo Hotel.
"all” more.
lbs Allie-u olslsllrhetasrs Anal-st
Its” Bank Currency.
One of the interesting features of the
campaign to the nupnjndioed observer
is the curious reco leotlons aroused in
theminds of 3hr men of mature years
bythepropositlon of the Democrats to
returnlotheusepfstatebenkcnrrency.
Those who remember its inconveniences
and the losses occasioned by its use be-
fore the present system of currency
into use are y alarmed
at proposition to-restore it. This is
especially true of the farmers. who are
annually-nest liable to be effected by
the circulation of currency of uncertain
values. President Livingston. of the
New York Farmers' Alliance. in a letter
on this so says:
Older In must look with dread upon
this midnight madness movement to re-
pealtheltaiohanktax if theywillrecal‘l
the condition of the currency prior to
the war. when the losses by counter-
.feits. broken banks and discounts were
appalling, and when many of the state
banks were started with the precon-
ceiv of swindllng the com
muni irresponsible and unscrupu-
sll street adventurers. from
THEMWWQ
Nancy Hanks and Her Great
Performance in Chicago.
RA]. POINTER [TKO 0? PACEBS.
The World's Record lilies of [anal and
Direct lollpsed at Waslllngton Perk.
.l'hs I’neu-afle lalky as a new team
CY BANKS,
that the world has
ever seen. Her re—
cent world's ree—
ord mile in 21W"
at W a s hi n g t on
perk. ‘Chleego,
over a regulation
circular t r a c k
second from the record
made by Suuol at Stockton. Csl.. last year,
and 1% seconds from Maud 8's previous
record of MB“. When Bunol reduced the
record of Maud 8 half a second on the kite
shaped track at Stockton. many horsemen
declared that the time was really no bet!
ter than that of Mood, for the reason that
the kite shaped track. with its two turns,
was at least half a second faster than the
circular course, with its four turns. over
which Mend made her world famous mile.
This argument cannot be used to detract
from the merit of Nancy Hanka' perfunc-
ance, for the gallant little more followed
the example of Hand 8 in making a new
record on the old style course. Had she
equaled Sunol’s saw her performance
would have been considered remarkable:
had she lowered the kite track record by
oucquarter of a second horsemen would
have been amazed, but when she made a
regulation track mile without a skip in
tom. 15‘ seconds below Maud 8‘s honored
mark. they were lhunderstruck. Nancy
drew a pneumatic tired sulky. and this
racing Vehicle, like the kite track. is un'
lous
whose offices the bills were issued, the
nominal location of the banks being
fixed at remote and obscure points. dild-
cult of access. to prevent the presenta-
tion of such issues for redemption. in
states whose laws required no security
for bill holders or depositors the moneys
orcustomers used for speculative pur—
poses were frequently lost or stolen,
whereby whole communities were robbed
withoutredress. Thebanks'iesueswere
by secret arrangements with exchange
otlices usually paid out to laborers and
operatives. in whose hands they fre-
quently became useless.
The whole country was,_deluged with
such so called money durum flush times
in Alabama and the south and west.
This state currency,known by these
tractive names of “Red Dog,” “Red
Jack,” "Wildcat," “Hard Shell," "Befo-
ty Fund,”“Slock Secured.” and other
styles as plentifqu issued. the most in-
NOT T00 UTE.
Ibo Would lot lat Ills- llsve e c..-
ussl. but—~—
,Tbcyaet on the shady side at a Lake
George steamer, and though it was only a
hall pound box of contrasts. it settled the
questiw Idomcstlc authority. lls eyes a
thlnyoung man with e nervous air. He
wore a mustache that was even more Insh-
ful than himself, and his face was so
heckled that if there were any more
freckles to come they ought to have been
”illiterate—"standing room only." His
entire outfit of clothing was new. from his
new and squeaky shoes to his thirty cent
necktie, equally now, though not squeaky,
and be ddgewd around on s steamer
camp steel with all acountry hrldegroom's
bashful (baldness. As for his companion.
it would have taken a Whores power
imagination working under forced draft
tothlnk her pretty. She had large blue
eyes and s prominently open mouth. lrom
which projected several large and muggy
teeth, like rock! at low tide. After the
fourthor filth landing he went into the
cabin and soon returned with a box of can
emels. She named much pleased at this
attention, and began the opening process
immediately. When finally the caramel
ratum was reached she extracts-l one,
handed it to her husband. reserved another
for herself. and then carefully tied up the
has again.
“If we are careful of these. Charles.
dear." she said brightly. "they’ll lost our
whole trip. You know we must bevery
economical. sweetheart."
Kn answering gloom of oneness and pride
played about among the freckles. Charles
ate his meager allowance of caramel in
silence, watched hers «beams-er within her
capacious mouth, and then he said. “Nice,
wasn't it 9"
"Delicious, dear.”
There was a moment’s silence.
”Wouldn't you kinder like another. Ma.
rial" he suggested.
”I think we ought to save them. Charles.
"
He looked longingly at the box with its
white pupsrnml gilt cord. and nervously
twirled the bit of oiled pager. sole reminder
of his caramel.
"Mnfltll
"Yes. darling."
"What was yours?”
"Strawberry. sweetheart.” she said lov—
ingly. "What was yours?"
“Fact is.” he said slowly. “i don’t know.
discreet that ever existed, and had none
of the elements of safety. convenience,
economy and good business manage-
ment. As a sequence it soon brought
thecouutryto thevergeof ruin. Losses
and shaves, counterfeits and broken
banks were calamities of daily occur-
rence with such a currency. To return
to it would be worse than idiotic. lt
would be a crime against the public. it
is diflcnlt for those who do not remem-
ber the old system. so fruitful in panics
and losses. to appreciate the convenience
andsafetyoftbenationsl bank circule
tion—uo countsrfeits, no losses to bill
holders or depositors. no broken banks
if the farmers, planters and laborers are
mindful of their interests, they will re
pudiste all schemes for swindling them
by a return to the old state bank absurd
ities.
"Puck's Bud Boy Dld It.”
doublcdly ‘ potent factorinmord m‘ Mebba one caramel may be enough {or
“‘9' Robertllouner.thefamauahoreeman yourllttla rosebud mouth, but. lcrmetu
who owns both Maud S ”d Sunol,and ketch the taste it takes two. Give mean
Trainer Charles Marvin, who drove Suuol other. Marla."
”1 h" "‘0'“ ”Win“ Wm‘m'm She didnotmove. She loolml off dream»
""9 Mb “‘1‘" m“ the M” "m" i’ lly over the lake and said quietly, “We
twoor three W “fl" ““3 “m one musn’t eat another till we get onthe train.
W i" “”- Cherles. deer. but mebbe 'taln't too late to
MW flavor now. sweetheart. if you
tats hard."—New York Tribune.‘
A "die A;- Glory.
Ems time during the Middle Ages there-
wae a village in Germany that had u get-
lowl of its own. it, however. not having
been used in many years. became unglued.
sotospeak, and fell into such a suite 0!
decay that it could not be repaired with-
out making a fresh gibbet.
Finally a highwsymau was caught
taking up a collection for the mmpaign
fund or some similar purpose, and without
any of tho delay peculiar to modern jus-
tice the wicked man was condemned to be
hung. All the accessories to n hanging
were on hand except the legal gitllOWS.
This estimate is probably somewhat ex. . In the midst of this dilemma it (recurred
“salted. but admitting that the pnen- tothe prqtrletors of the rickety ohl gall:
rustic sulky is I second faster Nancy lows that a neighboring village had a
Banks' feat atillstamps her ass modern comparatively new gallows which the in
trotting marvel. Mr. Bonner does not habitantsof Mid bars hsd erected.
think that Nancy llanks b any faster than What does the wt! of the first pm do
Sunni. and be is reported to have declared but take their maletactor over to the tom:
gnu-u. mutt, dun," 11.1.1. Wf. with the new gallows and suspend him
IAICY BAXIB, 2.173%.
andthe comparative meritsof Electinneer's tions of having reformed completely!
famous daughter and Nancy flanks must The allair was managed so quietly llml
remain unknown until a” two mt grog. the law was carried into street before the
ters meet in a was event not at all proprietors of the gibbet bad time to apply
hope not a wholly unprejudlced opinion. therefrom until he showed all the imliea ,5 5
Ilkelyto occur—or until Sunol.squlppcd
with s psomatic sulky. goes at the mile
record onaclmlar course. lnalew
wash Buuol will probably make an eflort
tongalnhercrownasqussu. N was
trained for her great test by Budd Dome
Bile weighed mpounds and pulled noble.
who weighed no pounds, and the or}.-
nd pneumatic sulky. The sulky Maud
used in 136, when she made her record
st 213%. weighed only 42 pounds. but the
pneumatic tire was unknown then.
Nancy Hanks ls shrown mere 5 years
old. She was bred near laxington. Ky..
by afarmer named ll. Boswell. llcr sire
wasthelamous Happy Medium. by ltye~
dyh’s llsmbletonlan, and her dam was a
well bred were named Nancy Lee, by llie
tutor. a full brother of Dexter, MTX, at
one timeking of all trailers. Haney llanks
was first heard of in use. when as a dyes-r-
old she dcfealedmloglood field emulated the
m in of production or both. “on with a of new. full she
He finds c the number «it lndivld- dds-W "we!“ S. ”We "M u-
, stallion king. and Belle llsmlln. and re.
' tlrsd withamarkoim lauyhorsernen
believed that I“ would use her reigning
segue». anoplnlcathatweswcllloomled.
Shebnowthspropertyotd. Isleolm
mum.who h repurtedtehsve
between m ‘1 mm for the
Grasswudsr.
~New York Press
Psak's Mela! Figures.
Here is Commissimer Peck's oflcial
statement as to the effect produced by
the IcKtnlcy lawon labor in New York
link:
He finds that in the wholesale manu-
facturiea of this state the wages paid
for the year ending Aug. ll, “59!.
showedanincreaseorsrthewsges paid
during the year ending Aug. Bl. 1m, of
$6,817,925.00.
lie finds that the net increase of pro
duction in the same time was “Laid;
180.08.
He finds that of sixty-seven industries
investigated 77 per cent. show an in-
tbswsgesefths «enhancem-
sssreprsssntsdwasmdlmhlleladfty-
one at thetradssrspsusmtadthsm
increase in wages per individual
i
.2
3“
F
lliéiiii
Effie“?
i
i
E
r
i
E
l
i
3
l
5.
§
fl“ W” M...
w was
mm
www.m‘sssls’llgtssho’t
“furtheUnlonudforthepfltyefths
UMestrkPrs-s
annual-s mam.
Mikhfllaablelohspm$
ep
Is densest haw-hydrant...
Winds. ream
or
a;
s:
r.ttrr
5
to the country court for an injunction.
The result was an indignation meeting
which appointed a committee todmw up
a petition to the grand duke to whom the
country belonged setting forth thcir grin-v
ance. The petition was clinched by the
following lrrelutable argument:
“Your royal highuess will more readily
perceive the injustice done us when we as
sure your royal hlghne- that the “would
gallows was built by us for the ruin-in-
accommodation of mmlves, our children
and our children's childreu."-'l'exas Silt
”little. the Ellen-es.
"I'll sell you that cow to! can." «aid
Farmer leddergms.
“1’" ‘l'O you only '50." Rpllul l'l'ir ',:
Wrath-max.
"Well. I’ll tell you what. PM do l'll split
the differencsaad take that." .
"Good enough! Here’s your at I'll drive
the cow home right now."
”What are you talking alum l" exclslm
ad leddergrase. "i want see more."
"Why do you want '30 more? Didn't
you agree to split the dilemma!"
“That's what I did; and that would
make the price of them on.”
“But you area little too last. Didn't you
at ”(or the cow Matt"
"res. and you sense $0th r'
”Innocence: t cranes
“In and mum?
“on,” Whetisthedldsreacs between
“I”
“mm“. anew”
"flatly; sadwhsnthettldlssplltiato
two putsthsresrs two ares. Isn't
that 9"
“Ya; hat"-
"l‘hsrs’snehutabeatls. Yeaspsedte
”Titthedilsrsnesandtaks that for the
mhstlfyeuwsat toga hack unyoul
lsuppossyou cause there were
new” Butdsn’tyoetry to trade
a...“ W'bflarper‘s
.An open letter» mserNo. 2.
May 25. '92. Syracuse, N. Y.
“Dear Madam :
“I want to tell yocwhat your
”gets”: Composed and San-
ativc Wash have done for me.
“I wassobadwithfalling of
the womb and Icuconheta that
I could not stand.
"‘1 had declared so much
without benefit 1 was entirely
discouraged I thought I had
to die.
“ One evening I read in the
‘ Herald’ about your medicine.
I got some, and took 2 bottles
of the Compound, and used one
of the Sanativc Wash.
"I believe it saved my life.
I am now well and at am
never troubled with either of
the complajnts. It more women
would use your
C o m p o u n d ,
there would be
less suffering in
the world."
Mrs. ids Caster. . .
”hum-fl It. ares-t
'1‘“.le km of Pill-or
on real” ulfll,
um"" .KT” '3' ,3. . .
dress. Lem Sums.- 1" %
Ian lsmosl. in. Less. 9%
lafl. uswfllhflc.
Il.l., New Haven & Hanlunl l. l.
Jllfil'l 5. 1892.
TRALVS LEAVE SOUTH NORWALK AS
FOLUJWS:
ton Sew \ouu. A. )f. —— 53 ex. Mo
or. s to local es.,656l. ex lather- Tubes. 8:!
emu}; local c1 rm.9tB es. 935 ac. lull ex.
ll 31localex. . M.—B-Iz2 ex. lll ac. 3'5) ex.
25¢ no.4"? ac. 43D cLliZ'pstcha. dt’iac.
diloldlffllu‘. Twex.?fiac.lttzlac.,llln.r5
Washington ex recs. Sundays—53 2L5“
er. “one. P. .41.”. runners-c;
for: bsw Haves. A. .~lw 5.; no ac.
Tau.,8&)ac.. bloom. 10“ ca. lofl sc. P.
3i.—~l2lll en. 1 l0 6.. l H at. :01 BL. 3m 1. ca.
3 L’ next 25: Lend be auto hridgrpurt 53mm; 2?
ar..‘.' lacs. 7:!» an. to bridge-port all M‘..9-hh
so. this Adams «as. and ac.. 125mm“ es.
Sundays—f. do so. 912 an. a. tn; 7 1!» er. 5:. m.
122.2... In. \\ :Lcll. ex. l (Ila. tn, Hwtam ex-
i‘ou llslrrsoan. A. )l.’61ll no" 93:. ex"
lmn er:. in it no. I”. M.- we en.) lo cr.. its
run: 7 15-1.. r ll M:..l2‘:)n. m. or.
inn HPNJNGI’IELD. A. .\l.~6 ltlac.. 915.91..
gall” rx. luctac. l’.M.—-l2w::., li-l an. i' idem.
ac.
PPS)!“ WHO? l. (3; 55;ng Sibel-cm Line}.
. ._ es. s. t. on. via
Hartford).
LIA“ NEW YORK
For: Hams Nonwans. A. 1—50! es.. so:
am. I til an. it on (-1., am 0;. 9|]! so" ll ill em.
it is an. 12m noon ex. P. 31.42 (Ian, l 10”..
r so ”.2 ill no.3 (Ii ex“ 3 an en. 4 u! cm, t Mex"
l :bs. .\. en. in: em. on» u.,e [2 es.. 701 set.
not an, 9:» Adams es. and ea. 12:» mid.
nirhl ex., Sundays A. M~~601 ac.. 7 mac. 1’. )1.
it at l. «1.. [Kill midnluht.
Horusatonlc'Railroad
Dsnbun and Ncmslk Division.
continental) T0 arm's? 6. use.
Trains leave South Xorwalk for beam: —-
6l3.vlf0a. In. l2ll.?.:l.4lfl. blllJpfllatsdl as
p. m. h'undayewllfia. m. and '2 is p. m.
’ljmins leave Denbnry for south Scramb-~
6:61, TKhblbnM ll 4.5a. In.. 3H5. t w and 62!)
p. m. Sundays—Jim; m and 5:05 p. In.
trains louvre) Ninth Sorwalk for Litrhflehl
amt poxnls on the Show”. Lllrhlleld and
Northern It. ll. lull a. m..t;."i . m,
Trains leave South Surwalfi for Ridgefleld»
llbamlvlaemq “H.123. 610 and twp. In.
Mint leave Ridgetlenl for South Somalis——
M5. 738. 91-6 and ll!» a. us. 35:. tfiand
p. m.
MAIN LINE DIVISION
.Tralns leave Bridgeport as follows:
. ll) n. nu. passenger tor i’iltstlehl.
mm a m., unsenger for l’ltlsneld. rushing
connections of Albany and the West.
It) lo a. an. fret ht for llawleyville.
lit 33-. n... fret; t for Brut Harrington.
Plltsl‘leld and Alhan w.
l y.
l'rmrr. General Superintendent.
ValAuvrvss. General
Fch ETT’S
I? sue STREET, Illllfltl.
To our friends and patrons we be: toen—
nouace that our spn importation- for I.
meow meivcduo w leh our attention is
respectful] invited. Open week we will
older viper liter ion In lllb e and flow-
rrs.two hand bone of Men to chases
frmn. Lulles can make selection now and we
will reservethetr order until later if chaired.
um lllEll Ill! "[8850 II THE
“TEST BTVLEB.
lsdlss'ownlstsrlel nsletoeresr
Milt w. Elwem.
cumulus.
announces-lists
Minstrels").
F. M. Pierce,
mew "new
“I” Tm “ Hull VII
”All!!! mm (it).
me
new use.
Mm.
fit-1W
“chem-33:
Mldeialisllui.touulninsnuahilimnl
lskingitthebutnoodesmleasshoeluthemsrkst. -
EVERY Pam waaflaurso. .-
Osll and examine them before purchasinganyothershoe, at
H. S. BROWN’S,
South Main Street. 80. Norwallr. '
[$92. RECEIVED l893.
MY fill AND WINTER WOIJLENS
For Gentleman's Wear.
w” -—-._.—
PLEASE CALL EARLY.
" W. H. Swords-
al
fih§fi7£§fili
Plumbing. Gas-Filling. Tin and Sheet Iron Work.”
Brick Set Ranges, Uncle Nick, Duchess and New York Ranges
best quality of Rubber Hose, Decorated China Din—-
ner and Tea Sets. Plain China, Agate and
Tin Ware at Lowest Prices.
Do You Want a Crriage?
GET ONE AT A BARGAIN
R
THE NEXT THIRTY DAYS.
BIG REDUCTION IN PRICES.
Don’t to at that Jobb'n ' s ' _
and deliver-Jig ’ 3’3 a Peclalty Orders called for
LUTHER WRIGHT,
Corner Madison and Franklin Streets.
s2"-
..
Glogfirfldtglsén
GOOD SHOES
laiies’ lid Oxfords. 151:. to $3.00.
laines’ lessen llllnlis. Sill!) to $2.50.
chills hi all Bessel! fills. in “.25.
Ian's hcsenllucher. finest i '
in $3.00. a" mm the " "m’
let's Basset a and etc and Soul lnolu. at $2.00.
Anything You Like in Ludles’ fills ’
Children’s Made to Order.838 and
GLOVEEE' OLSEN,
LEIDERS II THE 300T lllll SHOE TRIBE.
TIiE lElliNE ”all "tools “81‘6le
Tristram & Hyatt.
NO. 2 GAZETTE BUILDING.
tlorwalk.
New Dress Goods.
We are showingour entire new line of Fall Novelties in
DressGoods. Thelargeetlinethatwehaveever shown. We
hevestylesthatcanuotbetoundinenyother stereintownend
we gnaranteeour prices tobelowerthan the saute goods are
soldbycityhousee.
run ems M“. mlmmss.
We have a full line of rurOepea which we have just opened
Fur Trimmings in all width.
M Tristram & Hyatt.
NORWALK.
Norwalk Chronicler